MAX

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
MAX
1an2 max dimer2.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи MAX, bHLHd4, max, MYC associated factor X
Зовнішні ІД OMIM: 154950 MGI: 96921 HomoloGene: 1786 GeneCards: MAX
Пов'язані генетичні захворювання
Феохромоцитома, hereditary pheochromocytoma-paraganglioma[1]
Шаблон експресії
PBB GE MAX 214108 at fs.png

PBB GE MAX 208403 x at fs.png

PBB GE MAX 209331 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001146176
NM_008558
NM_001361663
NM_001361664
RefSeq (білок)
NP_001139648
NP_001348592
NP_001348593
NP_032584
Локус (UCSC) Хр. 14: 65.01 – 65.1 Mb Хр. 12: 76.94 – 76.96 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

MAX (англ. MYC associated factor X) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 160 амінокислот, а молекулярна маса — 18 275[5].

Послідовність амінокислот
1020304050
MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSV
PSLQGEKASRAQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVR
ALEKARSSAQLQTNYPSSDNSLYTNAKGSTISAFDGGSDSSSESEPEEPQ
SRKKLRMEAS

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, клітинних відростках.

Література[ред. | ред. код]

  • Blackwood E.M., Eisenman R.N. (1991). Max: a helix-loop-helix zipper protein that forms a sequence-specific DNA-binding complex with Myc.. Science 251: 1211 — 1217.  PubMed DOI:10.1126/science.2006410
  • Maekelae T.P., Koskinen P.J., Vaestrik I., Alitalo K. (1992). Alternative forms of Max as enhancers or suppressors of Myc-ras cotransformation.. Science 256: 373 — 377.  PubMed DOI:10.1126/science.256.5055.373
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ogawa H., Ishiguro K., Gaubatz S., Livingston D.M., Nakatani Y. (2002). A complex with chromatin modifiers that occupies E2F- and Myc-responsive genes in G0 cells.. Science 296: 1132 — 1136.  PubMed DOI:10.1126/science.1069861
  • Hillman R.T., Green R.E., Brenner S.E. (2004). An unappreciated role for RNA surveillance.. Genome Biol. 5: R8.1 — R8.16.  PubMed DOI:10.1186/gb-2004-5-2-r8
  • Ferre-D'Amare A.R., Prendergast G.C., Ziff E.B., Burley S.K. (1993). Recognition by Max of its cognate DNA through a dimeric b/HLH/Z domain.. Nature 363: 38 — 45.  PubMed DOI:10.1038/363038a0

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]