ESRRG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ESRRG
Protein ESRRG PDB 1kv6.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ESRRG, ERR3, ERRgamma, NR3B3, estrogen related receptor gamma, ERRg, ERR-gamma
Зовнішні ІД OMIM: 602969 MGI: 1347056 HomoloGene: 55581 GeneCards: ESRRG
Пов'язані генетичні захворювання
alcohol abuse, Значний депресивний розлад, Гіпертрофічна кардіоміопатія, unipolar depression[1]
Реагує на сполуку
biochanin A, daidzein, Геністейн, diethylstilbestrol[2]
Шаблон експресії
PBB GE ESRRG 207981 s at fs.png

PBB GE ESRRG 209966 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243792
NM_011935
NM_001357534
NM_001357535
NM_001357536
RefSeq (білок)
NP_001230721
NP_036065
NP_001344463
NP_001344464
NP_001344465
Локус (UCSC) Хр. 1: 216.5 – 217.14 Mb Хр. 1: 187.61 – 188.21 Mb
PubMed search [3] [4]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ESRRG (англ. Estrogen related receptor gamma) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [5] Довжина поліпептидного ланцюга білка становить 458 амінокислот, а молекулярна маса — 51 306[6].

Послідовність амінокислот
1020304050
MDSVELCLPESFSLHYEEELLCRMSNKDRHIDSSCSSFIKTEPSSPASLT
DSVNHHSPGGSSDASGSYSSTMNGHQNGLDSPPLYPSAPILGGSGPVRKL
YDDCSSTIVEDPQTKCEYMLNSMPKRLCLVCGDIASGYHYGVASCEACKA
FFKRTIQGNIEYSCPATNECEITKRRRKSCQACRFMKCLKVGMLKEGVRL
DRVRGGRQKYKRRIDAENSPYLNPQLVQPAKKPYNKIVSHLLVAEPEKIY
AMPDPTVPDSDIKALTTLCDLADRELVVIIGWAKHIPGFSTLSLADQMSL
LQSAWMEILILGVVYRSLSFEDELVYADDYIMDEDQSKLAGLLDLNNAIL
QLVKKYKSMKLEKEEFVTLKAIALANSDSMHIEDVEAVQKLQDVLHEALQ
DYEAGQHMEDPRRAGKMLMTLPLLRQTSTKAVQHFYNIKLEGKVPMHKLF
LEMLEAKV

Кодований геном білок за функціями належить до рецепторів, активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Heard D.J., Norby P.L., Holloway J., Vissing H. (2000). Human ERRgamma, a third member of the estrogen receptor-related receptor (ERR) subfamily of orphan nuclear receptors: tissue-specific isoforms are expressed during development and in the adult.. Mol. Endocrinol. 14: 382 — 392.  PubMed DOI:10.1210/mend.14.3.0431
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hong H., Yang L., Stallcup M.R. (1999). Hormone-independent transcriptional activation and coactivator binding by novel orphan nuclear receptor ERR3.. J. Biol. Chem. 274: 22618 — 22626.  PubMed DOI:10.1074/jbc.274.32.22618
  • Hentschke M., Borgmeyer U. (2003). Identification of PNRC2 and TLE1 as activation function-1 cofactors of the orphan nuclear receptor ERRgamma.. Biochem. Biophys. Res. Commun. 312: 975 — 982.  PubMed DOI:10.1016/j.bbrc.2003.11.025
  • Hentschke M., Suesens U., Borgmeyer U. (2009). Transcriptional ERRgamma2-mediated activation is regulated by sentrin-specific proteases.. Biochem. J. 419: 167 — 176.  PubMed DOI:10.1042/BJ20081556
  • Tremblay A.M., Wilson B.J., Yang X.-J., Giguere V. (2008). Phosphorylation-dependent sumoylation regulates estrogen-related receptor-alpha and -gamma transcriptional activity through a synergy control motif.. Mol. Endocrinol. 22: 570 — 584.  PubMed DOI:10.1210/me.2007-0357

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]