CNBP

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CNBP
Ідентифікатори
Символи CNBP, CNBP1, DM2, PROMM, RNF163, ZCCHC22, ZNF9, CCHC-type zinc finger nucleic acid binding protein
Зовнішні ІД OMIM: 116955 MGI: 88431 HomoloGene: 2567 GeneCards: CNBP
Шаблон експресії
PBB GE CNBP 206158 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001109745
NM_001109746
NM_013493
NM_001347325
NM_001355195
RefSeq (білок)
NP_001103215
NP_001103216
NP_001334254
NP_038521
NP_001342124
Локус (UCSC) Хр. 3: 129.17 – 129.18 Mb Хр. 6: 87.84 – 87.85 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CNBP (англ. CCHC-type zinc finger nucleic acid binding protein) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 177 амінокислот, а молекулярна маса — 19 463[4].

Послідовність амінокислот
1020304050
MSSNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSL
PDICYRCGESGHLAKDCDLQEDACYNCGRGGHIAKDCKEPKREREQCCYN
CGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINC
SKTSEVNCYRCGESGHLARECTIEATA

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Rajavashisth T.B., Taylor A.K., Andalibi A., Svenson K.L., Lusis A.J. (1989). Identification of a zinc finger protein that binds to the sterol regulatory element.. Science 245: 640 — 643.  PubMed DOI:10.1126/science.2562787
  • Flink I.L., Morkin E. (1995). Organization of the gene encoding cellular nucleic acid-binding protein.. Gene 163: 279 — 282.  PubMed DOI:10.1016/0378-1119(95)00421-2
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13164 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, P62633 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]