NEUROD1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NEUROD1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NEUROD1, BETA2, BHF-1, MODY6, NEUROD, bHLHa3, neuronal differentiation 1
Зовнішні ІД OMIM: 601724 MGI: 1339708 HomoloGene: 1871 GeneCards: NEUROD1
Шаблон експресії
PBB GE NEUROD1 206282 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002500
NM_010894
RefSeq (білок)
NP_002491
NP_035024
Локус (UCSC) Хр. 2: 181.67 – 181.68 Mb Хр. 2: 79.45 – 79.46 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NEUROD1 (англ. Neuronal differentiation 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 356 амінокислот, а молекулярна маса — 39 920[4].

Послідовність амінокислот
1020304050
MTKSYSESGLMGEPQPQGPPSWTDECLSSQDEEHEADKKEDDLETMNAEE
DSLRNGGEEEDEDEDLEEEEEEEEEDDDQKPKRRGPKKKKMTKARLERFK
LRRMKANARERNRMHGLNAALDNLRKVVPCYSKTQKLSKIETLRLAKNYI
WALSEILRSGKSPDLVSFVQTLCKGLSQPTTNLVAGCLQLNPRTFLPEQN
QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYS
AALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
MHYPAATLAGAQSHGSIFSGTAAPRCEIPIDNIMSFDSHSHHERVMSAQL
NAIFHD

Кодований геном білок за функціями належить до активаторів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, диференціація, нейрогенез, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Miyachi T., Maruyama H., Kitamura T., Nakamura S., Kawakami H. (1999). Structure and regulation of the human NeuroD (BETA2/BHF1) gene.. Brain Res. Mol. Brain Res. 69: 223 — 231.  PubMed DOI:10.1016/S0169-328X(99)00112-6
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Acharya H.R., Dooley C.M., Thoreson W.B., Ahmad I. (1997). cDNA cloning and expression analysis of NeuroD mRNA in human retina.. Biochem. Biophys. Res. Commun. 233: 459 — 463.  PubMed DOI:10.1006/bbrc.1997.6483
  • Ray S.K., Nishitani J., Petry M.W., Fessing M.Y., Leiter A.B. (2003). Novel transcriptional potentiation of BETA2/NeuroD on the secretin gene promoter by the DNA-binding protein Finb/RREB-1.. Mol. Cell. Biol. 23: 259 — 271.  PubMed DOI:10.1128/MCB.23.1.259-271.2003

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7762 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, Q13562 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]