AIRE

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
AIRE
Ідентифікатори
Символи APECED proteinAIREautoimmune regulatorautoimmune polyendocrinopathy candidiasis ectodermal dystrophy protein
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE AIRE 208090 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

AIRE (англ. Autoimmune regulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 545 амінокислот, а молекулярна маса — 57 727[2].

Послідовність амінокислот
1020304050
MATDAALRRLLRLHRTEIAVAVDSAFPLLHALADHDVVPEDKFQETLHLK
EKEGCPQAFHALLSWLLTQDSTAILDFWRVLFKDYNLERYGRLQPILDSF
PKDVDLSQPRKGRKPPAVPKALVPPPRLPTKRKASEEARAAAPAALTPRG
TASPGSQLKAKPPKKPESSAEQQRLPLGNGIQTMSASVQRAVAMSSGDVP
GARGAVEGILIQQVFESGGSKKCIQVGGEFYTPSKFEDSGSGKNKARSSS
GPKPLVRAKGAQGAAPGGGEARLGQQGSVPAPLALPSDPQLHQKNEDECA
VCRDGGELICCDGCPRAFHLACLSPPLREIPSGTWRCSSCLQATVQEVQP
RAEEPRPQEPPVETPLPPGLRSAGEEVRGPPGEPLAGMDTTLVYKHLPAP
PSAAPLPGLDSSALHPLLCVGPEGQQNLAPGARCGVCGDGTDVLRCTHCA
AAFHWRCHFPAGTSRPGTGLRCRSCSGDVTPAPVEGVLAPSPARLAPGPA
KDDTASHEPALHRDDLESLLSEHTFDGILQWAIQSMARPAAPFPS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Pitkaenen J., Vaehaemurto P., Krohn K.J.E., Peterson P. (2001). Subcellular localization of the autoimmune regulator protein. characterization of nuclear targeting and transcriptional activation domain.. J. Biol. Chem. 276: 19597 — 19602.  PubMed DOI:10.1074/jbc.M008322200
  • Mathis D., Benoist C. (2009). Aire.. Annu. Rev. Immunol. 27: 287 — 312.  PubMed DOI:10.1146/annurev.immunol.25.022106.141532
  • Anderson M.S., Su M.A. (2016). AIRE expands: new roles in immune tolerance and beyond.. Nat. Rev. Immunol. 16: 247 — 258.  PubMed DOI:10.1038/nri.2016.9
  • Chakravarty S., Zeng L., Zhou M.-M. (2009). Structure and site-specific recognition of histone H3 by the PHD finger of human autoimmune regulator.. Structure 17: 670 — 679.  PubMed DOI:10.1016/j.str.2009.02.017

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:360 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, O43918 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]