FOS

Матеріал з Вікіпедії — вільної енциклопедії.
(Перенаправлено з C-Fos)
Перейти до навігації Перейти до пошуку
FOS
Ідентифікатори
Символи Cellular oncogene fosFBJ murine osteosarcoma viral oncogene homologFOSactivator protein 1FBJ murine osteosarcoma viral (v-fos) oncogene homolog (oncogene FOS)Fos proto-oncogeneAP-1 trancription factor subunitG0/G1 switch regulatory protein 7proto-oncogene c-Foscellular oncogene c-fos
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE FOS 209189 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

FOS (англ. Fos proto-oncogene, AP-1 transcription factor subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 380 амінокислот, а молекулярна маса — 40 695[2].

Послідовність амінокислот
1020304050
MMFSGFNADYEASSSRCSSASPAGDSLSYYHSPADSFSSMGSPVNAQDFC
TDLAVSSANFIPTVTAISTSPDLQWLVQPALVSSVAPSQTRAPHPFGVPA
PSAGAYSRAGVVKTMTGGRAQSIGRRGKVEQLSPEEEEKRRIRRERNKMA
AAKCRNRRRELTDTLQAETDQLEDEKSALQTEIANLLKEKEKLEFILAAH
RPACKIPDDLGFPEEMSVASLDLTGGLPEVATPESEEAFTLPLLNDPEPK
PSVEPVKSISSMELKTEPFDDFLFPASSRPSGSETARSVPDMDLSGSFYA
ADWEPLHSGSLGMGPMATELEPLCTPVVTCTPSCTAYTSSFVFTYPEADS
FPSCAAAHRKGSSSNEPSSDSLSSPTLLAL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • van Straaten F., Mueller R., Curran T., Van Beveren C., Verma I.M. (1983). Complete nucleotide sequence of a human c-onc gene: deduced amino acid sequence of the human c-fos protein.. Proc. Natl. Acad. Sci. U.S.A. 80: 3183 — 3187.  PubMed DOI:10.1073/pnas.80.11.3183
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hai T., Liu F., Coukos W.J., Green M.R. (1989). Transcription factor ATF cDNA clones: an extensive family of leucine zipper proteins able to selectively form DNA-binding heterodimers.. Genes Dev. 3: 2083 — 2090.  PubMed DOI:10.1101/gad.3.12b.2083
  • Zhang Y., Feng X.H., Derynck R. (1998). Smad3 and Smad4 cooperate with c-Jun/c-Fos to mediate TGF-beta-induced transcription.. Nature 394: 909 — 913.  PubMed DOI:10.1038/29814
  • Murphy L.O., Smith S., Chen R.H., Fingar D.C., Blenis J. (2002). Molecular interpretation of ERK signal duration by immediate early gene products.. Nat. Cell Biol. 4: 556 — 564.  PubMed DOI:10.1038/ncb822
  • Portal M.M., Ferrero G.O., Caputto B.L. (2007). N-Terminal c-Fos tyrosine phosphorylation regulates c-Fos/ER association and c-Fos-dependent phospholipid synthesis activation.. Oncogene 26: 3551 — 3558.  PubMed DOI:10.1038/sj.onc.1210137

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:3796 (англ.). Процитовано 11 вересня 2017. 
  2. UniProt, P01100 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]