FOSL2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOSL2
Ідентифікатори
Символи FOSL2, Fos-Related Antigen, FRA-2, FRA2, FOS like 2, AP-1 transcription factor subunit
Зовнішні ІД OMIM: 601575 MGI: 102858 HomoloGene: 3845 GeneCards: FOSL2
Шаблон експресії
PBB GE FOSL2 205409 at fs.png

PBB GE FOSL2 218880 at fs.png

PBB GE FOSL2 218881 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005253
NM_008037
RefSeq (білок)
NP_005244
NP_032063
Локус (UCSC) Хр. 2: 28.39 – 28.42 Mb Хр. 5: 32.14 – 32.16 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOSL2 (англ. FOS like 2, AP-1 transcription factor subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 326 амінокислот, а молекулярна маса — 35 193[4].

Послідовність амінокислот
1020304050
MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPT
INAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRP
GVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTE
KLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRS
PPAPGLQPMRSGGGSVGAVVVKQEPLEEDSPSSSSAGLDKAQRSVIKPIS
IAGGFYGEEPLHTPIVVTSTPAVTPGTSNLVFTYPSVLEQESPASPSESC
SKAHRRSSSSGDQSSDSLNSPTLLAL

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033
  • Matsui M., Tokuhara M., Konuma Y., Nomura N., Ishizaki R. (1990). Isolation of human fos-related genes and their expression during monocyte-macrophage differentiation.. Oncogene 5: 249 — 255.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3798 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P15408 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]