NKX3-2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NKX3-2
Ідентифікатори
Символи NKX3-2, NK3 homeobox 2, BAPX1, NKX3.2, NKX3B, SMMD
Зовнішні ІД OMIM: 602183 MGI: 108015 HomoloGene: 68168 GeneCards: NKX3-2
Пов'язані генетичні захворювання
spondylo-megaepiphyseal-metaphyseal dysplasia[1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001189
NM_007524
RefSeq (білок)
NP_001180
NP_031550
Локус (UCSC) Хр. 4: 13.54 – 13.55 Mb Хр. 5: 41.76 – 41.76 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NKX3-2 (англ. NK3 homeobox 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 333 амінокислот, а молекулярна маса — 34 814[5].

Послідовність амінокислот
1020304050
MAVRGANTLTSFSIQAILNKKEERGGLAAPEGRPAPGGTAASVAAAPAVC
CWRLFGERDAGALGGAEDSLLASPAGTRTAAGRTAESPEGWDSDSALSEE
NESRRRCADARGASGAGLAGGSLSLGQPVCELAASKDLEEEAAGRSDSEM
SASVSGDRSPRTEDDGVGPRGAHVSALCSGAGGGGGSGPAGVAEEEEEPA
APKPRKKRSRAAFSHAQVFELERRFNHQRYLSGPERADLAASLKLTETQV
KIWFQNRRYKTKRRQMAADLLASAPAAKKVAVKVLVRDDQRQYLPGEVLR
PPSLLPLQPSYYYPYYCLPGWALSTCAAAAGTQ

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Tribioli C., Lufkin T. (1997). Molecular cloning, chromosomal mapping and developmental expression of BAPX1, a novel human homeobox-containing gene homologous to Drosophila bagpipe.. Gene 203: 225 — 233.  PubMed DOI:10.1016/S0378-1119(97)00520-9
  • Yoshiura K., Murray J.C. (1997). Sequence and chromosomal assignment of human BAPX1, a bagpipe-related gene, to 4p16.1: a candidate gene for skeletal dysplasia.. Genomics 45: 425 — 428.  PubMed DOI:10.1006/geno.1997.4926
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Tribioli C., Frasch M., Lufkin T. (1997). Bapx1: an evolutionary conserved homologue of the Drosophila bagpipe homeobox gene is expressed in splanchnic mesoderm and the embryonic skeleton.. Mech. Dev. 65: 145 — 162.  PubMed DOI:10.1016/S0925-4773(97)00067-1

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]