NR3C2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR3C2
Ідентифікатори
Символи mineralocorticoid receptor deltamineralocorticoid receptor 1NR3C2nuclear receptor subfamily 3group Cmember 2 variant 3aldosterone receptormineralocorticoid receptormineralocorticoid receptor 2
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE NR3C2 205259 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

NR3C2 (англ. Nuclear receptor subfamily 3 group C member 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [1] Довжина поліпептидного ланцюга білка становить 984 амінокислот, а молекулярна маса — 107 067[2].

Послідовність амінокислот
1020304050
METKGYHSLPEGLDMERRWGQVSQAVERSSLGPTERTDENNYMEIVNVSC
VSGAIPNNSTQGSSKEKQELLPCLQQDNNRPGILTSDIKTELESKELSAT
VAESMGLYMDSVRDADYSYEQQNQQGSMSPAKIYQNVEQLVKFYKGNGHR
PSTLSCVNTPLRSFMSDSGSSVNGGVMRAIVKSPIMCHEKSPSVCSPLNM
TSSVCSPAGINSVSSTTASFGSFPVHSPITQGTPLTCSPNAENRGSRSHS
PAHASNVGSPLSSPLSSMKSSISSPPSHCSVKSPVSSPNNVTLRSSVSSP
ANINNSRCSVSSPSNTNNRSTLSSPAASTVGSICSPVNNAFSYTASGTSA
GSSTLRDVVPSPDTQEKGAQEVPFPKTEEVESAISNGVTGQLNIVQYIKP
EPDGAFSSSCLGGNSKINSDSSFSVPIKQESTKHSCSGTSFKGNPTVNPF
PFMDGSYFSFMDDKDYYSLSGILGPPVPGFDGNCEGSGFPVGIKQEPDDG
SYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSARDQSFQHLSSF
PPVNTLVESWKSHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRPS
KICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKI
RRKNCPACRLQKCLQAGMNLGARKSKKLGKLKGIHEEQPQQQQPPPPPPP
PQSPEEGTTYIAPAKEPSVNTALVPQLSTISRALTPSPVMVLENIEPEIV
YAGYDSSKPDTAENLLSTLNRLAGKQMIQVVKWAKVLPGFKNLPLEDQIT
LIQYSWMCLSSFALSWRSYKHTNSQFLYFAPDLVFNEEKMHQSAMYELCQ
GMHQISLQFVRLQLTFEEYTIMKVLLLLSTIPKDGLKSQAAFEEMRTNYI
KELRKMVTKCPNNSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESH
ALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ліпідами, іонами металів, іоном цинку, ДНК, стероїдами. Локалізований у цитоплазмі, ядрі, мембрані, ендоплазматичному ретикулумі.

Література[ред. | ред. код]

  • Zennaro M.-C., Souque A., Viengchareun S., Poisson E., Lombes M. (2001). A new human MR splice variant is a ligand-independent transactivator modulating corticosteroid action.. Mol. Endocrinol. 15: 1586 — 1598.  PubMed DOI:10.1210/mend.15.9.0689
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hanukoglu A. (1991). Type I pseudohypoaldosteronism includes two clinically and genetically distinct entities with either renal or multiple target organ defects.. J. Clin. Endocrinol. Metab. 73: 936 — 944.  PubMed DOI:10.1210/jcem-73-5-936
  • Bloem L.J., Guo C., Pratt J.H. (1995). Identification of a splice variant of the rat and human mineralocorticoid receptor genes.. J. Steroid Biochem. Mol. Biol. 55: 159 — 162.  PubMed DOI:10.1016/0960-0760(95)00162-S
  • Zennaro M.-C., Farman N., Bonvalet J.-P., Lombes M. (1997). Tissue-specific expression of alpha and beta messenger ribonucleic acid isoforms of the human mineralocorticoid receptor in normal and pathological states.. J. Clin. Endocrinol. Metab. 82: 1345 — 1352.  PubMed DOI:10.1210/jcem.82.5.3933
  • Lupo B., Mesnier D., Auzou G. (1998). Cysteines 849 and 942 of human mineralocorticoid receptor are crucial for steroid binding.. Biochemistry 37: 12153 — 12159.  PubMed DOI:10.1021/bi980593e

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:7979 (англ.). Процитовано 30 серпня 2017. 
  2. UniProt, P08235 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]