PAX3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
PAX3
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи PAX3, CDHS, HUP2, WS1, WS3, Pax3, paired box 3
Зовнішні ІД OMIM: 606597 MGI: 97487 HomoloGene: 22494 GeneCards: PAX3
Пов'язані генетичні захворювання
craniofacial-deafness-hand syndrome, alveolar rhabdomyosarcoma[1]
Шаблон експресії
PBB GE PAX3 207680 x at fs.png

PBB GE PAX3 216059 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001159520
NM_008781
RefSeq (білок)
NP_001152992
NP_032807
Локус (UCSC) Хр. 2: 222.2 – 222.3 Mb Хр. 1: 78.1 – 78.2 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

PAX3 (англ. Paired box 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 479 амінокислот, а молекулярна маса — 52 968[5].

Послідовність амінокислот
1020304050
MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRP
LPNHIRHKIVEMAHHGIRPCVISRQLRVSHGCVSKILCRYQETGSIRPGA
IGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPS
VSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQ
SDEGSDIDSEPDLPLKRKQRRSRTTFTAEQLEELERAFERTHYPDIYTRE
ELAQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGFPPTAMP
TLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDS
SSAYCLPSTRHGFSSYTDSFVPPSGPSNPMNPTIGNGLSPQVMGLLTNHG
GVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYCP
PTYSTTGYSMDPVTGYQYGQYGQSKPWTF

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, нейрогенез, міогенез, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Macina R.A., Barr F.G., Galili N., Riethman H.C. (1995). Genomic organization of the human PAX3 gene: DNA sequence analysis of the region disrupted in alveolar rhabdomyosarcoma.. Genomics 26: 1 — 8.  PubMed DOI:10.1016/0888-7543(95)80076-X
  • Tsukamoto K., Nakamura Y., Niikawa N. (1994). Isolation of two isoforms of the PAX3 gene transcripts and their tissue-specific alternative expression in human adult tissues.. Hum. Genet. 93: 270 — 274.  PubMed DOI:10.1007/BF00212021
  • Hollenbach A.D., Sublett J.E., McPherson C.J., Grosveld G. (1999). The Pax3-FKHR oncoprotein is unresponsive to the Pax3-associated repressor hDaxx.. EMBO J. 18: 3702 — 3711.  PubMed DOI:10.1093/emboj/18.13.3702
  • Morell R., Friedman T.B., Moeljopawiro S., Hartono S., Asher J.H. Jr. (1992). A frameshift mutation in the HuP2 paired domain of the probable human homolog of murine Pax-3 is responsible for Waardenburg syndrome type 1 in an Indonesian family.. Hum. Mol. Genet. 1: 243 — 247.  PubMed DOI:10.1093/hmg/1.4.243
  • Wang Q., Kumar S., Slevin M., Kumar P. (2006). Functional analysis of alternative isoforms of the transcription factor PAX3 in melanocytes in vitro.. Cancer Res. 66: 8574 — 8580.  PubMed DOI:10.1158/0008-5472.CAN-06-0947

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]