NR1D1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR1D1
Protein NR1D1 PDB 1a6y.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR1D1, EAR1, THRA1, THRAL, ear-1, hRev, nuclear receptor subfamily 1 group D member 1, REVERBA, REVERBalpha
Зовнішні ІД OMIM: 602408 MGI: 2444210 HomoloGene: 23324 GeneCards: NR1D1
Реагує на сполуку
sr-9009, sr-9011[1]
Шаблон експресії
PBB GE NR1D1 31637 s at fs.png

PBB GE NR1D1 204760 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_021724
NM_145434
RefSeq (білок)
NP_068370
NP_663409
Локус (UCSC) Хр. 17: 40.09 – 40.1 Mb Хр. 11: 98.77 – 98.78 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR1D1 (англ. Nuclear receptor subfamily 1 group D member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 614 амінокислот, а молекулярна маса — 66 805[5].

Послідовність амінокислот
1020304050
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDNSNGSFQSLTQGCPT
YFPPSPTGSLTQDPARSFGSIPPSLSDDGSPSSSSSSSSSSSSFYNGSPP
GSLQVAMEDSSRVSPSKSTSNITKLNGMVLLCKVCGDVASGFHYGVHACE
GCKGFFRRSIQQNIQYKRCLKNENCSIVRINRNRCQQCRFKKCLSVGMSR
DAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSQCPLETSPTQHPTPGPM
GPSPPPAPVPSPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHREIF
TYAHDKLGSSPGNFNANHASGSPPATTPHRWENQGCPPAPNDNNTLAAQR
HNEALNGLRQAPSSYPPTWPPGPAHHSCHQSNSNGHRLCPTHVYAAPEGK
APANSPRQGNSKNVLLACPMNMYPHGRSGRTVQEIWEDFSMSFTPAVREV
VEFAKHIPGFRDLSQHDQVTLLKAGTFEVLMVRFASLFNVKDQTVMFLSR
TTYSLQELGAMGMGDLLSAMFDFSEKLNSLALTEEELGLFTAVVLVSADR
SGMENSASVEQLQETLLRALRALVLKNRPLETSRFTKLLLKLPDLRTLNN
MHSEKLLSFRVDAQ

Кодований геном білок за функціями належить до репресорів, рецепторів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, диференціація клітин, ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза, ДНК, гемом. Локалізований у цитоплазмі, ядрі, клітинних відростках.

Література[ред. | ред. код]

  • Lazar M.A., Jones K.E., Chin W.W. (1990). Isolation of a cDNA encoding human Rev-ErbA alpha: transcription from the noncoding DNA strand of a thyroid hormone receptor gene results in a related protein that does not bind thyroid hormone.. DNA Cell Biol. 9: 77 — 83.  PubMed DOI:10.1089/dna.1990.9.77
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Coste H., Rodriguez J.C. (2002). Orphan nuclear hormone receptor Rev-erbalpha regulates the human apolipoprotein CIII promoter.. J. Biol. Chem. 277: 27120 — 27129.  PubMed DOI:10.1074/jbc.M203421200
  • Yin L., Lazar M.A. (2005). The orphan nuclear receptor Rev-erbalpha recruits the N-CoR/histone deacetylase 3 corepressor to regulate the circadian Bmal1 gene.. Mol. Endocrinol. 19: 1452 — 1459.  PubMed DOI:10.1210/me.2005-0057
  • Wang J., Yin L., Lazar M.A. (2006). The orphan nuclear receptor Rev-erb alpha regulates circadian expression of plasminogen activator inhibitor type 1.. J. Biol. Chem. 281: 33842 — 33848.  PubMed DOI:10.1074/jbc.M607873200
  • Yin L., Wang J., Klein P.S., Lazar M.A. (2006). Nuclear receptor Rev-erbalpha is a critical lithium-sensitive component of the circadian clock.. Science 311: 1002 — 1005.  PubMed DOI:10.1126/science.1121613

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]