ZNF239

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF239
Ідентифікатори
Символи ZNF239, HOK-2, MOK2, zinc finger protein 239
Зовнішні ІД OMIM: 601069 MGI: 1306812 HomoloGene: 68480 GeneCards: ZNF239
Шаблон експресії
PBB GE ZNF239 206261 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001001792
NM_008616
NM_001360938
RefSeq (білок)
NP_001001792
NP_032642
NP_001347867
Локус (UCSC) Хр. 10: 43.56 – 43.57 Mb Хр. 6: 117.86 – 117.87 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF239 (англ. Zinc finger protein 239) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 10-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 458 амінокислот, а молекулярна маса — 51 591[4].

Послідовність амінокислот
1020304050
MASTITGSQDCIVNHRGEVDGEPELDISPCQQWGEASSPISRNRDSVMTL
QSGCFENIESETYLPLKVSSQIDTQDSSVKFCKNEPQDHQESRRLFVMEE
STERKVIKGESCSENLQVKLVSDGQELASPLLNGEATCQNGQLKESLDPI
DCNCKDIHGWKSQVVSCSQQRAHTEEKPCDHNNCGKILNTSPDGHPYEKI
HTAEKQYECSQCGKNFSQSSELLLHQRDHTEEKPYKCEQCGKGFTRSSSL
LIHQAVHTDEKPYKCDKCGKGFTRSSSLLIHHAVHTGEKPYKCDKCGKGF
SQSSKLHIHQRVHTGEKPYECEECGMSFSQRSNLHIHQRVHTGERPYKCG
ECGKGFSQSSNLHIHRCIHTGEKPYQCYECGKGFSQSSDLRIHLRVHTGE
KPYHCGKCGKGFSQSSKLLIHQRVHTGEKPYECSKCGKGFSQSSNLHIHQ
RVHKKDPR

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Ernoult-Lange M., Arranz V., le Coniat M., Berger R., Kress M. (1995). Human and mouse Kruppel-like (MOK2) orthologue genes encode two different zinc finger proteins.. J. Mol. Evol. 41: 784 — 794.  PubMed DOI:10.1007/BF00173158
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13031 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q16600 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]