RUNX1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RUNX1
PDB 1cmo EBI.jpg
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RUNX1, AML1, AML1-EVI-1, AMLCR1, CBF2alpha, CBFA2, EVI-1, PEBP2aB, PEBP2alpha, runt related transcription factor 1, RUNX family transcription factor 1
Зовнішні ІД OMIM: 151385 MGI: 99852 HomoloGene: 1331 GeneCards: RUNX1
Пов'язані генетичні захворювання
натуральна віспа, рак стравоходу, hereditary thrombocytopenia with normal platelets-hematological cancer predisposition syndrome[1]
Шаблон експресії
PBB GE RUNX1 209359 x at fs.png

PBB GE RUNX1 209360 s at fs.png

PBB GE RUNX1 208129 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001001890
NM_001122607
NM_001754
NM_001111021
NM_001111022
NM_001111023
NM_009821
RefSeq (білок)
NP_001001890
NP_001116079
NP_001745
н/д
Локус (UCSC) Хр. 21: 34.79 – 36 Mb Хр. 16: 92.6 – 92.83 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RUNX1 (англ. Runt related transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 453 амінокислот, а молекулярна маса — 48 737[5].

Послідовність амінокислот
1020304050
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRS
MVEVLADHPGELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDG
TLVTVMAGNDENYSAELRNATAAMKNQVARFNDLRFVGRSGRGKSFTLTI
TVFTNPPQVATYHRAIKITVDGPREPRRHRQKLDDQTKPGSLSFSERLSE
LEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQMQDTRQIQPSP
PWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL
TAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRY
HTYLPPPYPGSSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPR
ILPPCTNASTGSALLNPSLPNQSDVVEAEGSHSNSPTNMAPSARLEEAVW
RPY

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК, хлоридом. Локалізований у ядрі.

Література[ред. | ред. код]

  • Meyers S., Lenny N., Hiebert S.W. (1995). The t(8;21) fusion protein interferes with AML-1B-dependent transcriptional activation.. Mol. Cell. Biol. 15: 1974 — 1982.  PubMed DOI:10.1128/MCB.15.4.1974
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Ghozi M.C., Bernstein Y., Negreanu V., Levanon D., Groner Y. (1996). Expression of the human acute myeloid leukemia gene AML1 is regulated by two promoter regions.. Proc. Natl. Acad. Sci. U.S.A. 93: 1935 — 1940.  PubMed DOI:10.1073/pnas.93.5.1935
  • Daga A., Tighe J.E., Calabi F. (1992). Leukaemia/Drosophila homology.. Nature 356: 484 — 484.  PubMed DOI:10.1038/356484b0
  • Meyers S., Downing J.R., Hiebert S.W. (1993). Identification of AML-1 and the (8;21) translocation protein (AML-1/ETO) as sequence-specific DNA-binding proteins: the runt homology domain is required for DNA binding and protein-protein interactions.. Mol. Cell. Biol. 13: 6336 — 6345.  PubMed DOI:10.1128/MCB.13.10.6336
  • Bruhn L., Munnerlyn A., Grosschedl R. (1997). ALY, a context-dependent coactivator of LEF-1 and AML-1, is required for TCRalpha enhancer function.. Genes Dev. 11: 640 — 653.  PubMed DOI:10.1101/gad.11.5.640

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]