RARA

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RARA
Protein RARA PDB 1dkf.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи RARA, NR1B1, RAR, retinoic acid receptor alpha
Зовнішні ІД OMIM: 180240 MGI: 97856 HomoloGene: 20262 GeneCards: RARA
Реагує на сполуку
adapalene, alitretinoin, tamibarotene, tazarotene, Третиноїн[1]
Шаблон експресії
PBB GE RARA 203750 s at fs.png

PBB GE RARA 211605 s at fs.png

PBB GE RARA 203749 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000964
NM_001024809
NM_001033603
NM_001145301
NM_001145302
NM_001176528
NM_001177302
NM_001177303
NM_009024
NM_001361954
RefSeq (білок)
NP_001169999
NP_001170773
NP_001170774
NP_033050
NP_001348883
Локус (UCSC) Хр. 17: 40.31 – 40.36 Mb Хр. 11: 98.93 – 98.97 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RARA (англ. Retinoic acid receptor alpha) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 462 амінокислот, а молекулярна маса — 50 771[5].

Послідовність амінокислот
1020304050
MASNSSSCPTPGGGHLNGYPVPPYAFFFPPMLGGLSPPGALTTLQHQLPV
SGYSTPSPATIETQSSSSEEIVPSPPSPPPLPRIYKPCFVCQDKSSGYHY
GVSACEGCKGFFRRSIQKNMVYTCHRDKNCIINKVTRNRCQYCRLQKCFE
VGMSKESVRNDRNKKKKEVPKPECSESYTLTPEVGELIEKVRKAHQETFP
ALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFT
TLTIADQITLLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNA
GFGPLTDLVFAFANQLLPLEMDDAETGLLSAICLICGDRQDLEQPDRVDM
LQEPLLEALKVYVRKRRPSRPHMFPKMLMKITDLRSISAKGAERVITLKM
EIPGSMPPLIQEMLENSEGLDTLSGQPGGGGRDGGGLAPPPGSCSPSLSP
SSNRSSPATHSP

Кодований геном білок за функціями належить до рецепторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Giguere V., Ong E.S., Segui P., Evans R.M. (1987). Identification of a receptor for the morphogen retinoic acid.. Nature 330: 624 — 629.  PubMed DOI:10.1038/330624a0
  • Hjalt T.A.H., Murray J.C. (1999). Genomic structure of the human retinoic acid receptor-alpha1 gene.. Mamm. Genome 10: 528 — 529.  PubMed DOI:10.1007/s003359901036
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Brand N.J., Petkovich M., Chambon P. (1990). Characterization of a functional promoter for the human retinoic acid receptor-alpha (hRAR-alpha).. Nucleic Acids Res. 18: 6799 — 6806.  PubMed DOI:10.1093/nar/18.23.6799
  • Petkovich M., Brand N.J., Krust A., Chambon P. (1987). A human retinoic acid receptor which belongs to the family of nuclear receptors.. Nature 330: 444 — 450.  PubMed DOI:10.1038/330444a0
  • Shao W., Halachmi S., Brown M. (2002). ERAP140, a conserved tissue-specific nuclear receptor coactivator.. Mol. Cell. Biol. 22: 3358 — 3372.  PubMed DOI:10.1128/MCB.22.10.3358-3372.2002

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]