NPAS1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NPAS1
Ідентифікатори
Символи NPAS1, MOP5, PASD5, bHLHe11, neuronal PAS domain protein 1
Зовнішні ІД OMIM: 603346 MGI: 109205 HomoloGene: 1886 GeneCards: NPAS1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002517
NM_001321086
NM_008718
RefSeq (білок)
NP_001308015
NP_002508
NP_032744
Локус (UCSC) Хр. 19: 47.02 – 47.05 Mb Хр. 7: 16.46 – 16.48 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NPAS1 (англ. Neuronal PAS domain protein 1) – білок, який кодується однойменним геном, розташованим у людей на довгому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 590 амінокислот, а молекулярна маса — 62 702[4].

Послідовність амінокислот
1020304050
MAAPYPGSGGGSEVKCVGGRGASVPWDFLPGLMVKAPSGPCLQAQRKEKS
RNAARSRRGKENLEFFELAKLLPLPGAISSQLDKASIVRLSVTYLRLRRF
AALGAPPWGLRAAGPPAGLAPGRRGPAALVSEVFEQHLGGHILQSLDGFV
FALNQEGKFLYISETVSIYLGLSQVEMTGSSVFDYIHPGDHSEVLEQLGL
RTPTPGPPTPPSVSSSSSSSSSLADTPEIEASLTKVPPSSLVQERSFFVR
MKSTLTKRGLHVKASGYKVIHVTGRLRAHALGLVALGHTLPPAPLAELPL
HGHMIVFRLSLGLTILACESRVSDHMDLGPSELVGRSCYQFVHGQDATRI
RQSHVDLLDKGQVMTGYYRWLQRAGGFVWLQSVATVAGSGKSPGEHHVLW
VSHVLSQAEGGQTPLDAFQLPASVACEEASSPGPEPTEPEPPTEGKQAAP
AENEAPQTQGKRIKVEPGPRETKGSEDSGDEDPSSHPATPRPEFTSVIRA
GVLKQDPVRPWGLAPPGDPPPTLLHAGFLPPVVRGLCTPGTIRYGPAELG
LVYPHLQRLGPGPALPEAFYPPLGLPYPGPAGTRLPRKGD

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7894 (англ.). Процитовано 21 вересня 2017. 
  4. UniProt, Q99742 (англ.). Процитовано 21 вересня 2017. 

Див. також[ред. | ред. код]