ZNF318

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF318
Ідентифікатори
Символи ZNF318, TZF, ZFP318, HRIHFB2436, zinc finger protein 318
Зовнішні ІД OMIM: 617512 MGI: 1889348 HomoloGene: 22808 GeneCards: ZNF318
Шаблон експресії
PBB GE ZNF318 203521 s at fs.png

PBB GE ZNF318 203520 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_014345
NM_021346
NM_207671
RefSeq (білок)
NP_055160
NP_067321
NP_997554
Локус (UCSC) Хр. 6: 43.31 – 43.37 Mb Хр. 17: 46.38 – 46.42 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZNF318 (англ. Zinc finger protein 318) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 2 279 амінокислот, а молекулярна маса — 251 112[4].

Послідовність амінокислот
1020304050
MYRSSARSSVSSHRPKDDGGGGPRSGRSSGSSSGPARRSSPPPPPSGSSS
RTPARRPRSPSGHRGRRASPSPPRGRRVSPSPPRARRGSPSPPRGRRLFP
PGPAGFRGSSRGESRADYARDGRGDHPGDSGSRRRSPGLCSDSLEKSLRI
TVGNDHFCVSTPERRRLSDRLGSPVDNLEDMDRDDLTDDSVFTRSSQCSR
GLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPHISCHDELLRGT
ERNREKLKGYSIRSEERSREAKRPRYDDTVKINSMGGDHPSFTSGTRNYR
QRRRSPSPRFLDPEFRELDLARRKREEEEERSRSLSQELVGVDGGGTGCS
IPGLSGVLTASEPGYSLHRPEEVSVMPKKSILKKRIEVDIMEPSMQLESF
SSSTSSSQDHPLYSGHPSLPLSGAIAAFASEIENKGTMVETALKEPQGNL
YQWGPLPGIPKDNSPLREKFGSFLCHKDNLDLKAEGPERHTDFLLPHERA
SQDGSGFSRILSMLADSTSTQEKRRRSFPDIEDEEKFLYGDEEEDLKAES
VPKPLGSSESEVMRQKASSLPSSAPAVKLESLEETNPEYAKIHDLLKTIG
LDIGVAEISQLAARTQERLHGKKPSLRSSADRRSSVDRYFSADHCSSVDH
RFSADRCSSVDHCFSADRRSSDPHRLESREAHHSNTHSPEVSHPHPPSPV
DPYLLTKNSPPFLKSDHPVGHISGPEVVGSGFQSSVAVRCMLPSAPSAPI
RLPHTAALSQFHMPRASQFAAARIPPNYQGPAIPPASFDAYRHYMAYAAS
RWPMYPTSQPSNHPVPEPHRIMPITKQATRSRPNLRVIPTVTPDKPKQKE
SLRGSIPAAQVPVQVSIPSLIRYNPEKISDEKNRASQKQKVIEEREKLKN
DREARQKKMYYLRTELERLHKQQGEMLRKKRREKDGHKDPLLVEVSRLQD
NIMKDIAELRQEAEEAEKKQSELDKVAQILGINIFDKSQKSLSDSREPTE
KPGKAEKSKSPEKVSSFSNSSSNKESKVNNEKFRTKSPKPAESPQSATKQ
LDQPTAAYEYYDAGNHWCKDCNTICGTMFDFFTHMHNKKHTQTLDPYNRP
WASKTQSEAKQDAIKRTDKITVPAKGSEFLVPISGFYCQLCEEFLGDPIS
GEQHVKGHQHNEKYKKYVDENPLYEERRNLDRQAGLAVVLETERRRQSEL
KRKLSEKPKEEKKEKKAKAVKEVKEDDKVSEKLEDQLSEGRNSPEKAENK
RNTGIKLQLKEEVKKESPTSSSFGKFSWKKPEKEEEKSSLVTPSISKEEI
LESSKDKEDGKTEAGKAKPIKIKLSGKTVVAHTSPWMPVVTTSTQTKIRP
NLPIPSTVLRKSCSATMSKPAPLNTFLSIKSSGTTAKPLPVVKESSADLL
LPPDIISKAFGGEEVILKGSPEEKVVLAEKSEPSHLPEQILPPPPPPPPP
PPPPPPVIPHPAAPSAAQANAILAPVKSNPVVSQTLSPGFVGPNILNPVL
PVAIMASAQPAAIPSDETAPGVSESDRDQTLFSVLVRPPPPLSSVFSEQA
KKLEKRNSCLATANAKDLYDIFYSSGGKGAPETKGAPETKLSGGPLANGE
NSNLSRTKSSDTSSTSPLNSSASQEELHQDEGLVAAPIVSNSEKPIAKTL
VALGKWSVVEHVGPKSTGSTYGFLQPLTRLCQSRPYETITPKTDTLAIWT
SSSFQSDTSRDISPEKSELDLGEPGPPGVEPPPQLLDIQCKESQKLVEIH
LRESVNQDKESQELRKSEDCRESEIETNTELKERVKELSEGIVDEGVSTS
IGPHSIDDSNLNHGNRYMWEGEVKQPNLLMIDKEAEQSNKLMTGSETPSK
VVIKLSPQACSFTKAKLDSFLSEARSLLNPQDTPVKISAPELLLHSPARS
AMCLTGSPQEQGVSVVSEEGLENSAPESASRTSRYRSLKLKRERSKDFQV
KKIYELAVWDENKKRPETWESPEKPKTEALELQDVHPELTVTIESKALED
FEATDLKVEELTALGNLGDMPVDFCTTRVSPAHRSPTVLCQKVCEENSVS
PIGCNSSDPADFEPIPSFSGFPLDSPKTLVLDFETEGERNSPNPRSVRIP
SPNILKTGLTENVDRGLGGLEGTHQALDLLAGGMMPEEVKESSQLDKQES
LGLELKTINSAGLGPSPCLPDLVDFVTRTSGVQKDKLCSPLSEPGDPSKC
SSLELGPLQLEISNASTTEVAILQVDDDSGDPLNLVKAPVSRSPPREQVI
EDNMVPQGMPEQETTVGAIQDHTESSVHN

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, мейоз, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13578 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, Q5VUA4 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]