TBX3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TBX3
Protein TBX3 PDB 1h6f.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TBX3, TBX3-ISO, UMS, XHL, T-box 3, T-box transcription factor 3
Зовнішні ІД OMIM: 601621 MGI: 98495 HomoloGene: 4371 GeneCards: TBX3
Пов'язані генетичні захворювання
колоректальний рак, ulnar-mammary syndrome[1]
Шаблон експресії
PBB GE TBX3 219682 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_016569
NM_005996
NM_011535
NM_198052
RefSeq (білок)
NP_005987
NP_057653
NP_035665
NP_932169
Локус (UCSC) Хр. 12: 114.67 – 114.68 Mb Хр. 5: 119.67 – 119.68 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TBX3 (англ. T-box 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 743 амінокислот, а молекулярна маса — 79 389[5].

Послідовність амінокислот
1020304050
MSLSMRDPVIPGTSMAYHPFLPHRAPDFAMSAVLGHQPPFFPALTLPPNG
AAALSLPGALAKPIMDQLVGAAETGIPFSSLGPQAHLRPLKTMEPEEEVE
DDPKVHLEAKELWDQFHKRGTEMVITKSGRRMFPPFKVRCSGLDKKAKYI
LLMDIIAADDCRYKFHNSRWMVAGKADPEMPKRMYIHPDSPATGEQWMSK
VVTFHKLKLTNNISDKHGFTLAFPSDHATWQGNYSFGTQTILNSMHKYQP
RFHIVRANDILKLPYSTFRTYLFPETEFIAVTAYQNDKITQLKIDNNPFA
KGFRDTGNGRREKRKQLTLQSMRVFDERHKKENGTSDESSSEQAAFNCFA
QASSPAASTVGTSNLKDLCPSEGESDAEAESKEEHGPEACDAAKISTTTS
EEPCRDKGSPAVKAHLFAAERPRDSGRLDKASPDSRHSPATISSSTRGLG
AEERRSPVREGTAPAKVEEARALPGKEAFAPLTVQTDAAAAHLAQGPLPG
LGFAPGLAGQQFFNGHPLFLHPSQFAMGGAFSSMAAAGMGPLLATVSGAS
TGVSGLDSTAMASAAAAQGLSGASAATLPFHLQQHVLASQGLAMSPFGSL
FPYPYTYMAAAAAASSAAASSSVHRHPFLNLNTMRPRLRYSPYSIPVPVP
DGSSLLTTALPSMAAAAGPLDGKVAALAASPASVAVDSGSELNSRSSTLS
SSSMSLSPKLCAEKEAATSELQSIQRLVSGLEAKPDRSRSASP

Кодований геном білок за функціями належить до репресорів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • He M.-L., Wen L., Campbell C.E., Wu J.Y., Rao Y. (1999). Transcription repression by Xenopus ET and its human ortholog TBX3, a gene involved in ulnar-mammary syndrome.. Proc. Natl. Acad. Sci. U.S.A. 96: 10212 — 10217.  PubMed DOI:10.1073/pnas.96.18.10212
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Coll M., Seidman J.G., Muller C.W. (2002). Structure of the DNA-bound T-box domain of human TBX3, a transcription factor responsible for ulnar-mammary syndrome.. Structure 10: 343 — 356.  PubMed DOI:10.1016/S0969-2126(02)00722-0

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]