E4F1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
E4F1
Ідентифікатори
Символи E4F1, E4F, E4F transcription factor 1
Зовнішні ІД OMIM: 603022 MGI: 109530 HomoloGene: 3259 GeneCards: E4F1
Шаблон експресії
PBB GE E4F1 218524 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001288776
NM_001288778
NM_004424
NM_001301784
NM_007893
NM_001355708
RefSeq (білок)
NP_001275705
NP_001275707
NP_004415
NP_001288713
NP_031919
NP_001342637
Локус (UCSC) Хр. 16: 2.22 – 2.24 Mb Хр. 17: 24.44 – 24.47 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

E4F1 (англ. E4F transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 16-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 784 амінокислот, а молекулярна маса — 83 496[4].

Послідовність амінокислот
1020304050
MEGAMAVRVTAAHTAEAQAEAGREAGEGAVAAVAAALAPSGFLGLPAPFS
EEDEDDVHRCGRCQAEFTALEDFVQHKIQKACQRAPPEALPATPATTALL
GQEVVPAAPGPEEPITVAHIVVEAASLAADISHASDLVGGGHIKEVIVAA
EAELGDGEMAEAPGSPRQQGLGLAGEGEQAQVKLLVNKDGRYVCALCHKT
FKTGSILKAHMVTHSSRKDHECKLCGASFRTKGSLIRHHRRHTDERPYKC
SKCGKSFRESGALTRHLKSLTPCTEKIRFSVSKDVVVSKEDARAGSGAGA
AGLGTATSSVTGEPIETSPVIHLVTDAKGTVIHEVHVQMQELSLGMKALA
PEPPVSQELPCSSEGSRENLLHQAMQNSGIVLERAAGEEGALEPAPAAGS
SPQPLAVAAPQLPVLEVQPLETQVASEASAVPRTHPCPQCSETFPTAATL
EAHKRGHTGPRPFACAQCGKAFPKAYLLKKHQEVHVRERRFRCGDCGKLY
KTIAHVRGHRRVHSDERPYPCPKCGKRYKTKNAQQVHFRTHLEEKPHVCQ
FCSRGFREKGSLVRHVRHHTGEKPFKCYKCGRGFAEHGTLNRHLRTKGGC
LLEVEELLVSEDSPAAATTVLTEDPHTVLVEFSSVVADTQEYIIEATADD
AETSEATEIIEGTQTEVDSHIMKVVQQIVHQASAGHQIIVQNVTMDEETA
LGPEAAAADTITIATPESLTEQVAMTLASAISEGTVLAARAGTSGTEQAT
VTMVSSEDIEILEHAGELVIASPEGQLEVQTVIV

Кодований геном білок за функціями належить до трансфераз, репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, клітинний цикл, поділ клітини, мітоз, убіквітинування білків, регуляція росту. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Fernandes E.R., Rooney R.J. (1997). The adenovirus E1A-regulated transcription factor E4F is generated from the human homolog of nuclear factor phiAP3.. Mol. Cell. Biol. 17: 1890 — 1903.  PubMed DOI:10.1128/MCB.17.4.1890
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fernandes E.R., Zhang J.Y., Rooney R.J. (1998). Adenovirus E1A-regulated transcription factor p120E4F inhibits cell growth and induces the stabilization of the cdk inhibitor p21WAF1.. Mol. Cell. Biol. 18: 459 — 467.  PubMed DOI:10.1128/MCB.18.1.459
  • Rooney R.J., Rothammer K., Fernandes E.R. (1998). Mutational analysis of p50E4F suggests that DNA binding activity is mediated through an alternative structure in a zinc finger domain that is regulated by phosphorylation.. Nucleic Acids Res. 26: 1681 — 1688.  PubMed DOI:10.1093/nar/26.7.1681
  • Fernandes E.R., Rooney R.J. (1999). Suppression of E1A-mediated transformation by the p50E4F transcription factor.. Mol. Cell. Biol. 19: 4739 — 4749.  PubMed DOI:10.1128/MCB.19.7.4739
  • Colombo R., Draetta G.F., Chiocca S. (2003). Modulation of p120E4F transcriptional activity by the Gam1 adenoviral early protein.. Oncogene 22: 2541 — 2547.  PubMed DOI:10.1038/sj.onc.1206379

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3121 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q66K89 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]