HOXB6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HOXB6
Protein HOXB6 PDB 1ahd.png
Ідентифікатори
Символи HOXB6, HOX2, HOX2B, HU-2, Hox-2.2, homeobox B6
Зовнішні ІД OMIM: 142961 MGI: 96187 HomoloGene: 7366 GeneCards: HOXB6
Шаблон експресії
PBB GE HOXB6 205366 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_018952
NM_156036
NM_156037
NM_001369397
NM_008269
RefSeq (білок)
NP_061825
NP_001356326
NP_032295
Локус (UCSC) Хр. 17: 48.6 – 48.6 Mb Хр. 11: 96.29 – 96.3 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HOXB6 (англ. Homeobox B6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 224 амінокислот, а молекулярна маса — 25 432[4].

Послідовність амінокислот
1020304050
MSSYFVNSTFPVTLASGQESFLGQLPLYSSGYADPLRHYPAPYGPGPGQD
KGFATSSYYPPAGGGYGRAAPCDYGPAPAFYREKESACALSGADEQPPFH
PEPRKSDCAQDKSVFGETEEQKCSTPVYPWMQRMNSCNSSSFGPSGRRGR
QTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMK
WKKESKLLSASQLSAEEEEEKQAE

Кодований геном білок за функціями належить до білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Shen W.-F., Detmer K., Simonitch-Eason T.A., Lawrence H.J., Largman C. (1991). Alternative splicing of the HOX 2.2 homeobox gene in human hematopoietic cells and murine embryonic and adult tissues.. Nucleic Acids Res. 19: 539 — 545.  PubMed DOI:10.1093/nar/19.3.539
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Levine M., Rubin G.M., Tjian R. (1984). Human DNA sequences homologous to a protein coding region conserved between homeotic genes of Drosophila.. Cell 38: 667 — 673.  PubMed DOI:10.1016/0092-8674(84)90261-7

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5117 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P17509 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]