OTX2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
OTX2
Protein OTX2 PDB 2dms.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи OTX2, CPHD6, MCOPS5, Orthodenticle homeobox 2
Зовнішні ІД OMIM: 600037 MGI: 97451 HomoloGene: 11026 GeneCards: OTX2
Шаблон експресії
PBB GE OTX2 gnf1h00384 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001270523
NM_001270524
NM_001270525
NM_021728
NM_172337
RefSeq (білок)
NP_001257452
NP_001257453
NP_001257454
NP_068374
NP_758840
н/д
Локус (UCSC) Хр. 14: 56.8 – 56.82 Mb Хр. 14: 48.66 – 48.67 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

OTX2 (англ. Orthodenticle homeobox 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 14-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 289 амінокислот, а молекулярна маса — 31 636[4].

Послідовність амінокислот
1020304050
MMSYLKQPPYAVNGLSLTTSGMDLLHPSVGYPATPRKQRRERTTFTRAQL
DVLEALFAKTRYPDIFMREEVALKINLPESRVQVWFKNRRAKCRQQQQQQ
QNGGQNKVRPAKKKTSPAREVSSESGTSGQFTPPSSTSVPTIASSSAPVS
IWSPASISPLSDPLSTSSSCMQRSYPMTYTQASGYSQGYAGSTSYFGGMD
CGSYLTPMHHQLPGPGATLSPMGTNAVTSHLNQSPASLSTQGYGASSLGF
NSTTDCLDYKDQTASWKLNFNADCLDYKDQTSSWKFQVL

Кодований геном білок за функцією належить до білків розвитку. Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Fong S.L., Fong W.B. (1999). Elements regulating the transcription of human interstitial retinoid-binding protein (IRBP) gene in cultured retinoblastoma cells.. Curr. Eye Res. 18: 283 — 291.  PubMed DOI:10.1076/ceyr.18.4.283.5360
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Larsen K.B., Lutterodt M., Rath M.F., Moeller M. (2009). Expression of the homeobox genes PAX6, OTX2, and OTX1 in the early human fetal retina.. Int. J. Dev. Neurosci. 27: 485 — 492.  PubMed DOI:10.1016/j.ijdevneu.2009.04.004
  • Diaczok D., Romero C., Zunich J., Marshall I., Radovick S. (2008). A novel dominant negative mutation of OTX2 associated with combined pituitary hormone deficiency.. J. Clin. Endocrinol. Metab. 93: 4351 — 4359.  PubMed DOI:10.1210/jc.2008-1189

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:8522 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P32243 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]