NFATC1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFATC1
Protein NFATC1 PDB 1a66.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NFATC1, NF-ATC, NFAT2, NFATc, NF-ATc1.2, nuclear factor of activated T-cells 1, nuclear factor of activated T cells 1
Зовнішні ІД OMIM: 600489 MGI: 102469 HomoloGene: 32336 GeneCards: NFATC1
Шаблон експресії
PBB GE NFATC1 209664 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
н/д
Локус (UCSC) Хр. 18: 79.4 – 79.53 Mb Хр. 18: 80.61 – 80.71 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFATC1 (англ. Nuclear factor of activated T-cells 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 943 амінокислот, а молекулярна маса — 101 243[4].

Послідовність амінокислот
1020304050
MPSTSFPVPSKFPLGPAAAVFGRGETLGPAPRAGGTMKSAEEEHYGYASS
NVSPALPLPTAHSTLPAPCHNLQTSTPGIIPPADHPSGYGAALDGGPAGY
FLSSGHTRPDGAPALESPRIEITSCLGLYHNNNQFFHDVEVEDVLPSSKR
SPSTATLSLPSLEAYRDPSCLSPASSLSSRSCNSEASSYESNYSYPYASP
QTSPWQSPCVSPKTTDPEEGFPRGLGACTLLGSPRHSPSTSPRASVTEES
WLGARSSRPASPCNKRKYSLNGRQPPYSPHHSPTPSPHGSPRVSVTDDSW
LGNTTQYTSSAIVAAINALTTDSSLDLGDGVPVKSRKTTLEQPPSVALKV
EPVGEDLGSPPPPADFAPEDYSSFQHIRKGGFCDQYLAVPQHPYQWAKPK
PLSPTSYMSPTLPALDWQLPSHSGPYELRIEVQPKSHHRAHYETEGSRGA
VKASAGGHPIVQLHGYLENEPLMLQLFIGTADDRLLRPHAFYQVHRITGK
TVSTTSHEAILSNTKVLEIPLLPENSMRAVIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQPSGRTLSLQVASNPIECSQRSAQELPLVEK
QSTDSYPVVGGKKMVLSGHNFLQDSKVIFVEKAPDGHHVWEMEAKTDRDL
CKPNSLVVEIPPFRNQRITSPVHVSFYVCNGKRKRSQYQRFTYLPANVPI
IKTEPTDDYEPAPTCGPVSQGLSPLPRPYYSQQLAMPPDPSSCLVAGFPP
CPQRSTLMPAAPGVSPKLHDLSPAAYTKGVASPGHCHLGLPQPAGEAPAV
QDVPRPVATHPGSPGQPPPALLPQQVSAPPSSSCPPGLEHSLCPSSPSPP
LPPATQEPTCLQPCSPACPPATGRPQHLPSTVRRDESPTAGPRLLPEVHE
DGSPNLAPIPVTVKREPEELDQLYLDDVNEIIRNDLSSTSTHS

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Park J., Takeuchi A., Sharma S. (1996). Characterization of a new isoform of the NFAT (nuclear factor of activated T cells) gene family member NFATc.. J. Biol. Chem. 271: 20914 — 20921.  PubMed DOI:10.1074/jbc.271.34.20914
  • Vihma H., Pruunsild P., Timmusk T. (2008). Alternative splicing and expression of human and mouse NFAT genes.. Genomics 92: 279 — 291.  PubMed DOI:10.1016/j.ygeno.2008.06.011
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lyakh L., Ghosh P., Rice N.R. (1997). Expression of NFAT-family proteins in normal human T cells.. Mol. Cell. Biol. 17: 2475 — 2484.  PubMed DOI:10.1128/MCB.17.5.2475
  • Beals C.R., Sheridan C.M., Turck C.W., Gardner P., Crabtree G.R. (1997). Nuclear export of NF-ATc enhanced by glycogen synthase kinase-3.. Science 275: 1930 — 1934.  PubMed DOI:10.1126/science.275.5308.1930
  • Crabtree G.R. (1999). Generic signals and specific outcomes: signaling through Ca2+, calcineurin, and NF-AT.. Cell 96: 611 — 614.  PubMed DOI:10.1016/S0092-8674(00)80571-1

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7775 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, O95644 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]