TBPL1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TBPL1
Ідентифікатори
Символи TBPL1, MGC:8389, MGC:9620, STUD, TLF, TLP, TRF2, TATA-box binding protein like 1
Зовнішні ІД OMIM: 605521 MGI: 1339946 HomoloGene: 3577 GeneCards: TBPL1
Шаблон експресії
PBB GE TBPL1 208398 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004865
NM_001253676
NM_011603
RefSeq (білок)
NP_001240605
NP_004856
NP_035733
Локус (UCSC) Хр. 6: 133.95 – 133.99 Mb Хр. 10: 22.7 – 22.73 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TBPL1 (англ. TATA-box binding protein like 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 186 амінокислот, а молекулярна маса — 20 887[4].

Послідовність амінокислот
1020304050
MDADSDVALDILITNVVCVFRTRCHLNLRKIALEGANVIYKRDVGKVLMK
LRKPRITATIWSSGKIICTGATSEEEAKFGARRLARSLQKLGFQVIFTDF
KVVNVLAVCNMPFEIRLPEFTKNNRPHASYEPELHPAVCYRIKSLRATLQ
IFSTGSITVTGPNVKAVATAVEQIYPFVFESRKEIL

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Rabenstein M.D., Zhou S., Lis J.T., Tjian R. (1999). TATA box-binding protein (TBP)-related factor 2 (TRF2), a third member of the TBP family.. Proc. Natl. Acad. Sci. U.S.A. 96: 4791 — 4796.  PubMed DOI:10.1073/pnas.96.9.4791
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11589 (англ.). Процитовано 6 вересня 2017. 
  4. UniProt, P62380 (англ.). Процитовано 6 вересня 2017. 

Див. також[ред. | ред. код]