RUNX2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
RUNX2
Protein RUNX2 PDB 1cmo.png
Ідентифікатори
Символи RUNX2, AML3, CBF-alpha-1, CBFA1, CCD, CCD1, CLCD, OSF-2, OSF2, PEA2aA, PEBP2aA, runt related transcription factor 2, Runx2 mRNA, RUNX family transcription factor 2
Зовнішні ІД OMIM: 600211 MGI: 99829 HomoloGene: 68389 GeneCards: RUNX2
Пов'язані генетичні захворювання
metaphyseal dysplasia-maxillary hypoplasia-brachydacty syndrome[1]
Шаблон експресії
PBB GE RUNX2 216994 s at fs.png

PBB GE RUNX2 221282 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001015051
NM_001024630
NM_001278478
NM_004348
NM_001369405
RefSeq (білок)
NP_001015051
NP_001019801
NP_001265407
NP_001356334
Локус (UCSC) Хр. 6: 45.33 – 45.66 Mb Хр. 17: 44.5 – 44.81 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

RUNX2 (англ. Runt related transcription factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 6-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 521 амінокислот, а молекулярна маса — 56 648[5].

Послідовність амінокислот
1020304050
MASNSLFSTVTPCQQNFFWDPSTSRRFSPPSSSLQPGKMSDVSPVVAAQQ
QQQQQQQQQQQQQQQQQQQQQEAAAAAAAAAAAAAAAAAVPRLRPPHDNR
TMVEIIADHPAELVRTDSPNFLCSVLPSHWRCNKTLPVAFKVVALGEVPD
GTVVTVMAGNDENYSAELRNASAVMKNQVARFNDLRFVGRSGRGKSFTLT
ITVFTNPPQVATYHRAIKVTVDGPREPRRHRQKLDDSKPSLFSDRLSDLG
RIPHPSMRVGVPPQNPRPSLNSAPSPFNPQGQSQITDPRQAQSSPPWSYD
QSYPSYLSQMTSPSIHSTTPLSSTRGTGLPAITDVPRRISDDDTATSDFC
LWPSTLSKKSQAGASELGPFSDPRQFPSISSLTESRFSNPRMHYPATFTY
TPPVTSGMSLGMSATTHYHTYLPPPYPGSSQSQSGPFQTSSTPYLYYGTS
SGSYQFPMVPGGDRSPSRMLPPCTTTSNGSTLLNPNLPNQNDGVDADGSH
SSSPTVLNSSGRMDESVWRPY

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Geoffroy V., Corral D.A., Zhou L., Lee B., Karsenty G. (1998). Genomic organization, expression of the human CBFA1 gene, and evidence for an alternative splicing event affecting protein function.. Mamm. Genome 9: 54 — 57.  PubMed DOI:10.1007/s003359900679
  • Xiao Z.S., Thomas R., Hinson T.K., Quarles L.D. (1998). Genomic structure and isoform expression of the mouse, rat and human Cbfa1/Osf2 transcription factor.. Gene 214: 187 — 197.  PubMed DOI:10.1016/S0378-1119(98)00227-3
  • Zhang Y.-W., Bae S.-C., Takahashi E., Ito Y. (1997). The cDNA cloning of the transcripts of human PEBP2alphaA/CBFA1 mapped to 6p12.3-p21.1, the locus for cleidocranial dysplasia.. Oncogene 15: 367 — 371.  PubMed DOI:10.1038/sj.onc.1201352
  • Pelletier N., Champagne N., Stifani S., Yang X.-J. (2002). MOZ and MORF histone acetyltransferases interact with the Runt-domain transcription factor Runx2.. Oncogene 21: 2729 — 2740.  PubMed DOI:10.1038/sj.onc.1205367
  • Machuca-Tzili L., Monroy-Jaramillo N., Gonzalez-del Angel A., Kofman-Alfaro S. (2002). New mutations in the CBFA1 gene in two Mexican patients with cleidocranial dysplasia.. Clin. Genet. 61: 349 — 353.  PubMed DOI:10.1034/j.1399-0004.2002.610505.x
  • Otto F., Kanegane H., Mundlos S. (2002). Mutations in the RUNX2 gene in patients with cleidocranial dysplasia.. Hum. Mutat. 19: 209 — 216.  PubMed DOI:10.1002/humu.10043

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]