SP4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SP4
Protein SP4 PDB 1va1.png
Ідентифікатори
Символи SP4, HF1B, SPR-1, Sp4 transcription factor
Зовнішні ІД OMIM: 600540 MGI: 107595 HomoloGene: 2341 GeneCards: SP4
Пов'язані генетичні захворювання
Значний депресивний розлад, unipolar depression[1]
Шаблон експресії
PBB GE SP4 206663 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003112
NM_001326542
NM_001326543
NM_001166385
NM_009239
RefSeq (білок)
NP_001313471
NP_001313472
NP_003103
н/д
Локус (UCSC) Хр. 7: 21.43 – 21.51 Mb Хр. 12: 118.23 – 118.3 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SP4 (англ. Sp4 transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 784 амінокислот, а молекулярна маса — 81 985[5].

Послідовність амінокислот
1020304050
MSDQKKEEEEEAAAAAAMATEGGKTSEPENNNKKPKTSGSQDSQPSPLAL
LAATCSKIGTPGENQATGQQQIIIDPSQGLVQLQNQPQQLELVTTQLAGN
AWQLVASTPPASKENNVSQPASSSSSSSSSNNGSASPTKTKSGNSSTPGQ
FQVIQVQNPSGSVQYQVIPQLQTVEGQQIQINPTSSSSLQDLQGQIQLIS
AGNNQAILTAANRTASGNILAQNLANQTVPVQIRPGVSIPLQLQTLPGTQ
AQVVTTLPINIGGVTLALPVINNVAAGGGTGQVGQPAATADSGTSNGNQL
VSTPTNTTTSASTMPESPSSSTTCTTTASTSLTSSDTLVSSADTGQYAST
SASSSERTIEESQTPAATESEAQSSSQLQPNGMQNAQDQSNSLQQVQIVG
QPILQQIQIQQPQQQIIQAIPPQSFQLQSGQTIQTIQQQPLQNVQLQAVN
PTQVLIRAPTLTPSGQISWQTVQVQNIQSLSNLQVQNAGLSQQLTITPVS
SSGGTTLAQIAPVAVAGAPITLNTAQLASVPNLQTVSVANLGAAGVQVQG
VPVTITSVAGQQQGQDGVKVQQATIAPVTVAVGGIANATIGAVSPDQLTQ
VHLQQGQQTSDQEVQPGKRLRRVACSCPNCREGEGRGSNEPGKKKQHICH
IEGCGKVYGKTSHLRAHLRWHTGERPFICNWMFCGKRFTRSDELQRHRRT
HTGEKRFECPECSKRFMRSDHLSKHVKTHQNKKGGGTALAIVTSGELDSS
VTEVLGSPRIVTVAAISQDSNPATPNVSTNMEEF

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hagen G., Mueller S., Beato M., Suske G. (1992). Cloning by recognition site screening of two novel GT box binding proteins: a family of Sp1 related genes.. Nucleic Acids Res. 20: 5519 — 5525.  PubMed DOI:10.1093/nar/20.21.5519
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]