ZBTB21

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB21
Protein ZNF295 PDB 1wjp.png
Наявні структури
PDBПошук для людей: PDBe RCSB
Ідентифікатори
Символи ZBTB21, ZNF295, zinc finger and BTB domain containing 21
Зовнішні ІД OMIM: 616485 MGI: 1927240 HomoloGene: 10799 GeneCards: ZBTB21
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001098402
NM_001098403
NM_020727
NM_001320729
NM_001320731
NM_001081684
NM_001081685
NM_175428
NM_001320385
RefSeq (білок)
NP_001091872
NP_001091873
NP_001307658
NP_001307660
NP_065778
н/д
Локус (UCSC) Хр. 21: 41.99 – 42.01 Mb Хр. 16: 97.94 – 97.96 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB21 (англ. Zinc finger and BTB domain containing 21) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 066 амінокислот, а молекулярна маса — 118 870[4].

Послідовність амінокислот
1020304050
MEGLLHYINPAHAISLLSALNEERLKGQLCDVLLIVGDQKFRAHKNVLAA
SSEYFQSLFTNKENESQTVFQLDFCEPDAFDNVLNYIYSSSLFVEKSSLA
AVQELGYSLGISFLTNIVSKTPQAPFPTCPNRKKVFVEDDENSSQKRSVI
VCQSRNEAQGKTVSQNQPDVSHTSRPSPSIAVKANTNKPHVPKPIEPLHN
LSLTEKSWPKDSSVVYAKSLEHSGSLDDPNRISLVKRNAVLPSKPLQDRE
AMDDKPGVSGQLPKGKALELALKRPRPPVLSVCSSSETPYLLKETNKGNG
QGEDRNLLYYSKLGLVIPSSGSGSGNQSIDRSGPLVKSLLRRSLSMDSQV
PVYSPSIDLKSSQGSSSVSSDAPGNVLCALSQKSSLKDCSEKTALDDRPQ
VLQPHRLRSFSASQSTDREGASPVTEVRIKTEPSSPLSDPSDIIRVTVGD
AATTAAASSSSVTRDLSLKTEDDQKDMSRLPAKRRFQADRRLPFKKLKVN
EHGSPVSEDNFEEGSSPTLLDADFPDSDLNKDEFGELEGTRPNKKFKCKH
CLKIFRSTAGLHRHVNMYHNPEKPYACDICHKRFHTNFKVWTHCQTQHGI
VKNPSPASSSHAVLDEKFQRKLIDIVREREIKKALIIKLRRGKPGFQGQS
SSQAQQVIKRNLRSRAKGAYICTYCGKAYRFLSQFKQHIKMHPGEKPLGV
NKVAKPKEHAPLASPVENKEVYQCRLCNAKLSSLLEQGSHERLCRNAAVC
PYCSLRFFSPELKQEHESKCEYKKLTCLECMRTFKSSFSIWRHQVEVHNQ
NNMAPTENFSLPVLDHNGDVTGSSRPQSQPEPNKVNHIVTTKDDNVFSDS
SEQVNFDSEDSSCLPEDLSLSKQLKIQVKEEPVEEAEEEAPEASTAPKEA
GPSKEASLWPCEKCGKMFTVHKQLERHQELLCSVKPFICHVCNKAFRTNF
RLWSHFQSHMSQASEESAHKESEVCPVPTNSPSPPPLPPPPPLPKIQPLE
PDSPTGLSENPTPATEKLFVPQESDTLFYHAPPLSAITFKRQFMCKLCHR
TFKTAFSLWSHEQTHN

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Wang J., Kudoh J., Takayanagi A., Shimizu N. (2005). Novel human BTB/POZ domain-containing zinc finger protein ZNF295 is directly associated with ZFP161.. Biochem. Biophys. Res. Commun. 327: 615 — 627.  PubMed DOI:10.1016/j.bbrc.2004.12.048
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:13083 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q9ULJ3 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]