FOXM1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXM1
Protein FOXM1 PDB 3G73.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи FOXM1, FKHL16, FOXM1B, HFH-11, HFH11, HNF-3, INS-1, MPHOSPH2, MPP-2, MPP2, PIG29, TGT3, TRIDENT, forkhead box M1, FOXM1A, FOXM1C
Зовнішні ІД OMIM: 602341 MGI: 1347487 HomoloGene: 7318 GeneCards: FOXM1
Шаблон експресії
PBB GE FOXM1 202580 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001243088
NM_001243089
NM_021953
NM_202002
NM_202003
NM_008021
RefSeq (білок)
NP_001230017
NP_001230018
NP_068772
NP_973731
NP_973732
н/д
Локус (UCSC) Хр. 12: 2.86 – 2.88 Mb Хр. 6: 128.36 – 128.38 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXM1 (англ. Forkhead box M1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 763 амінокислот, а молекулярна маса — 84 283[4].

Послідовність амінокислот
1020304050
MKTSPRRPLILKRRRLPLPVQNAPSETSEEEPKRSPAQQESNQAEASKEV
AESNSCKFPAGIKIINHPTMPNTQVVAIPNNANIHSIITALTAKGKESGS
SGPNKFILISCGGAPTQPPGLRPQTQTSYDAKRTEVTLETLGPKPAARDV
NLPRPPGALCEQKRETCADGEAAGCTINNSLSNIQWLRKMSSDGLGSRSI
KQEMEEKENCHLEQRQVKVEEPSRPSASWQNSVSERPPYSYMAMIQFAIN
STERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETS
ANGKVSFWTIHPSANRYLTLDQVFKPLDPGSPQLPEHLESQQKRPNPELR
RNMTIKTELPLGARRKMKPLLPRVSSYLVPIQFPVNQSLVLQPSVKVPLP
LAASLMSSELARHSKRVRIAPKVLLAEEGIAPLSSAGPGKEEKLLFGEGF
SPLLPVQTIKEEEIQPGEEMPHLARPIKVESPPLEEWPSPAPSFKEESSH
SWEDSSQSPTPRPKKSYSGLRSPTRCVSEMLVIQHRERRERSRSRRKQHL
LPPCVDEPELLFSEGPSTSRWAAELPFPADSSDPASQLSYSQEVGGPFKT
PIKETLPISSTPSKSVLPRTPESWRLTPPAKVGGLDFSPVQTSQGASDPL
PDPLGLMDLSTTPLQSAPPLESPQRLLSSEPLDLISVPFGNSSPSDIDVP
KPGSPEPQVSGLAANRSLTEGLVLDTMNDSLSKILLDISFPGLDEDPLGP
DNINWSQFIPELQ

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, клітинний цикл, пошкодження ДНК, репарація ДНК, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Yao K.-M., Sha M., Lu Z., Wong G.G. (1997). Molecular analysis of a novel winged helix protein, WIN. Expression pattern, DNA binding property, and alternative splicing within the DNA binding domain.. J. Biol. Chem. 272: 19827 — 19836.  PubMed DOI:10.1074/jbc.272.32.19827
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Westendorf J.M., Rao P.N., Gerace L. (1994). Cloning of cDNAs for M-phase phosphoproteins recognized by the MPM2 monoclonal antibody and determination of the phosphorylated epitope.. Proc. Natl. Acad. Sci. U.S.A. 91: 714 — 718.  PubMed DOI:10.1073/pnas.91.2.714
  • Tan Y., Raychaudhuri P., Costa R.H. (2007). Chk2 mediates stabilization of the FoxM1 transcription factor to stimulate expression of DNA repair genes.. Mol. Cell. Biol. 27: 1007 — 1016.  PubMed DOI:10.1128/MCB.01068-06
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3818 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, Q08050 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]