SMAD4

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SMAD4
Ідентифікатори
Символи deleted in pancreatic carcinoma locus 4hSMAD4deletion target in pancreatic carcinoma 4SMADmothers against DPP homolog 4SMAD4MAD homolog 4mothers against decapentaplegic homolog 4mothers against decapentaplegicDrosophilahomolog of4SMAD 4
Зовнішні ІД GeneCards: [1]
Шаблон експресії
PBB GE SMAD4 202527 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

SMAD4 (англ. SMAD family member 4) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 552 амінокислот, а молекулярна маса — 60 439[2].

Послідовність амінокислот
1020304050
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK
KDELDSLITAITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWR
WPDLHKNELKHVKYCQYAFDLKCDSVCVNPYHYERVVSPGIDLSGLTLQS
NAPSSMMVKDEYVHDFEGQPSLSTEGHSIQTIQHPPSNRASTETYSTPAL
LAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQ
NGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTV
DGYVDPSGGDRFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVR
CLSDHAVFVQSYYLDREAGRAPGDAVHKIYPSAYIKVFDLRQCHRQMQQQ
AATAQAAAAAQAAAVAGNIPGPGSVGGIAPAISLSAAAGIGVDDLRRLCI
LRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVLHTMPIADPQP
LD

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Zhang Y., Feng X.-H., Wu R.-Y., Derynck R. (1996). Receptor-associated Mad homologues synergize as effectors of the TGF-beta response.. Nature 383: 168 — 172.  PubMed DOI:10.1038/383168a0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Liu F., Pouponnot C., Massague J. (1997). Dual role of the Smad4/DPC4 tumor suppressor in TGFbeta-inducible transcriptional complexes.. Genes Dev. 11: 3157 — 3167.  PubMed DOI:10.1101/gad.11.23.3157
  • Kawabata M., Inoue H., Hanyu A., Imamura T., Miyazono K. (1998). Smad proteins exist as monomers in vivo and undergo homo- and hetero-oligomerization upon activation by serine/threonine kinase receptors.. EMBO J. 17: 4056 — 4065.  PubMed DOI:10.1093/emboj/17.14.4056
  • Jiao K., Zhou Y., Hogan B.L.M. (2002). Identification of mZnf8, a mouse Kruppel-like transcriptional repressor, as a novel nuclear interaction partner of Smad1.. Mol. Cell. Biol. 22: 7633 — 7644.  PubMed DOI:10.1128/MCB.22.21.7633-7644.2002
  • Chen H.B., Rud J.G., Lin K., Xu L. (2005). Nuclear targeting of transforming growth factor-beta-activated Smad complexes.. J. Biol. Chem. 280: 21329 — 21336.  PubMed DOI:10.1074/jbc.M500362200

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:6770 (англ.). Процитовано 12 вересня 2017. 
  2. UniProt, Q13485 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]