E2F2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
E2F2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи E2F2, E2F-2, E2F transcription factor 2
Зовнішні ІД OMIM: 600426 MGI: 1096341 HomoloGene: 48264 GeneCards: E2F2
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_004091
NM_177733
NM_183301
NM_001305399
RefSeq (білок)
NP_004082
NP_001292328
NP_808401
Локус (UCSC) Хр. 1: 23.51 – 23.53 Mb Хр. 4: 136.17 – 136.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

E2F2 (англ. E2F transcription factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 437 амінокислот, а молекулярна маса — 47 506[4].

Послідовність амінокислот
1020304050
MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYP
QTAPPAAAPGTCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVP
EFPTPKGKCIRVDGLPSPKTPKSPGEKTRYDTSLGLLTKKFIYLLSESED
GVLDLNWAAEVLDVQKRRIYDITNVLEGIQLIRKKAKNNIQWVGRGMFED
PTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTEDKANKRLAYV
TYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVP
APAPTPQQAPPPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPL
ISFSPSLDQDDYLWGLEAGEGISDLFDSYDLGDLLIN

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, клітинний цикл, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rubin S.M., Gall A.-L., Zheng N., Pavletich N.P. (2005). Structure of the Rb C-terminal domain bound to E2F1-DP1: a mechanism for phosphorylation-induced E2F release.. Cell 123: 1093 — 1106.  PubMed DOI:10.1016/j.cell.2005.09.044
  • Lee C., Chang J.H., Lee H.S., Cho Y. (2002). Structural basis for the recognition of the E2F transactivation domain by the retinoblastoma tumor suppressor.. Genes Dev. 16: 3199 — 3212.  PubMed DOI:10.1101/gad.1046102

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3114 (англ.). Процитовано 25 серпня 2017. 
  4. UniProt, Q14209 (англ.). Процитовано 25 серпня 2017. 

Див. також[ред. | ред. код]