CLOCK

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
CLOCK
Circadian CLOCK protein.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи CLOCK, KAT13D, bHLHe8, clock circadian regulator
Зовнішні ІД OMIM: 601851 MGI: 99698 HomoloGene: 3603 GeneCards: CLOCK
Шаблон експресії
PBB GE CLOCK 204980 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001267843
NM_004898
NM_007715
NM_001289826
NM_001305222
RefSeq (білок)
NP_001254772
NP_004889
NP_001276755
NP_001292151
NP_031741
Локус (UCSC) Хр. 4: 55.43 – 55.55 Mb Хр. 5: 76.21 – 76.3 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

CLOCK (англ. Clock circadian regulator) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 846 амінокислот, а молекулярна маса — 95 304[4].

Послідовність амінокислот
1020304050
MLFTVSCSKMSSIVDRDDSSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQF
NVLIKELGSMLPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDW
KPTFLSNEEFTQLMLEALDGFFLAIMTDGSIIYVSESVTSLLEHLPSDLV
DQSIFNFIPEGEHSEVYKILSTHLLESDSLTPEYLKSKNQLEFCCHMLRG
TIDPKEPSTYEYVKFIGNFKSLNSVSSSAHNGFEGTIQRTHRPSYEDRVC
FVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIW
LQTHYYITYHQWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAA
DKSQDSGSDNRINTVSLKEALERFDHSPTPSASSRSSRKSSHTAVSDPSS
TPTKIPTDTSTPPRQHLPAHEKMVQRRSSFSSQSINSQSVGSSLTQPVMS
QATNLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEANIHRQQEELRK
IQEQLQMVHGQGLQMFLQQSNPGLNFGSVQLSSGNSSNIQQLAPINMQGQ
VVPTNQIQSGMNTGHIGTTQHMIQQQTLQSTSTQSQQNVLSGHSQQTSLP
SQTQSTLTAPLYNTMVISQPAAGSMVQIPSSMPQNSTQSAAVTTFTQDRQ
IRFSQGQQLVTKLVTAPVACGAVMVPSTMLMGQVVTAYPTFATQQQQSQT
LSVTQQQQQQSSQEQQLTSVQQPSQAQLTQPPQQFLQTSRLLHGNPSTQL
ILSAAFPLQQSTFPQSHHQQHQSQQQQQLSRHRTDSLPDPSKVQPQ

Кодований геном білок за функціями належить до трансфераз, активаторів, ацилтрансфераз, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, пошкодження ДНК, біологічні ритми, поліморфізм. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Rutter J., Reick M., Wu L.C., McKnight S.L. (2001). Regulation of clock and NPAS2 DNA binding by the redox state of NAD cofactors.. Science 293: 510 — 514.  PubMed DOI:10.1126/science.1060698
  • Ward S.M., Fernando S.J., Hou T.Y., Duffield G.E. (2010). The transcriptional repressor ID2 can interact with the canonical clock components CLOCK and BMAL1 and mediate inhibitory effects on mPer1 expression.. J. Biol. Chem. 285: 38987 — 39000.  PubMed DOI:10.1074/jbc.M110.175182
  • Ye R., Selby C.P., Ozturk N., Annayev Y., Sancar A. (2011). Biochemical analysis of the canonical model for the mammalian circadian clock.. J. Biol. Chem. 286: 25891 — 25902.  PubMed DOI:10.1074/jbc.M111.254680
  • Richards J., Gumz M.L. (2013). Mechanism of the circadian clock in physiology.. Am. J. Physiol. 304: R1053 — R1064.  PubMed DOI:10.1152/ajpregu.00066.2013
  • Eckel-Mahan K., Sassone-Corsi P. (2013). Metabolism and the circadian clock converge.. Physiol. Rev. 93: 107 — 135.  PubMed DOI:10.1152/physrev.00016.2012

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:2082 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, O15516 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]