ETV6

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ETV6
Protein ETV6 PDB 1ji7.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ETV6, TEL, TEL/ABL, THC5, ETS variant 6, ETS variant transcription factor 6
Зовнішні ІД OMIM: 600618 MGI: 109336 HomoloGene: 37560 GeneCards: ETV6
Пов'язані генетичні захворювання
Гострий мієлоїдний лейкоз[1]
Шаблон експресії
PBB GE ETV6 205585 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001987
NM_007961
NM_001303102
RefSeq (білок)
NP_001978
NP_001290031
NP_031987
Локус (UCSC) Хр. 12: 11.65 – 11.9 Mb Хр. 6: 134.04 – 134.27 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ETV6 (англ. ETS variant 6) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 452 амінокислот, а молекулярна маса — 53 000[5].

Послідовність амінокислот
1020304050
MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRL
PAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKE
DFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQ
NHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRP
LRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSE
SHPKPSSPRQESTRVIQLMPSPIMHPLILNPRHSVDFKQSRLSEDGLHRE
GKPINLSHREDLAYMNHIMVSVSPPEEHAMPIGRIADCRLLWDYVYQLLS
DSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRTNMTYEKMSRALRH
YYKLNIIRKEPGQRLLFRFMKTPDEIMSGRTDRLEHLESQELDEQIYQED
EC

Кодований геном білок за функціями належить до репресорів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Golub T.R., Barker G.F., Lovett M., Gilliland D.G. (1994). Fusion of PDGF receptor beta to a novel ets-like gene, tel, in chronic myelomonocytic leukemia with t(5;12) chromosomal translocation.. Cell 77: 307 — 316.  PubMed DOI:10.1016/0092-8674(94)90322-0
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Baens M., Peeters P., Guo C., Aerssens J., Marynen P. (1996). Genomic organization of TEL: the human ETS-variant gene 6.. Genome Res. 6: 404 — 413.  PubMed DOI:10.1101/gr.6.5.404
  • Boccuni P., MacGrogan D., Scandura J.M., Nimer S.D. (2003). The human L(3)MBT Polycomb group protein is a transcriptional repressor and interacts physically and functionally with TEL (ETV6).. J. Biol. Chem. 278: 15412 — 15420.  PubMed DOI:10.1074/jbc.M300592200
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]