FOXE1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXE1
Ідентифікатори
Символи thyroid transcription factor 2TTF-2forkhead box protein E2forkhead box protein E1HFKL5HNF-3/fork head-like protein 5HFKH4forkhead-related protein FKHL15FOXE1forkheaddrosophilahomolog-like 15
Зовнішні ІД GeneCards: [1]
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
н/д
н/д
RefSeq (білок)
н/д
н/д
Локус (UCSC) н/д н/д
PubMed search н/д н/д
Вікідані
Див./Ред. для людей

FOXE1 (англ. Forkhead box E1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[1] Довжина поліпептидного ланцюга білка становить 373 амінокислот, а молекулярна маса — 38 076[2].

Послідовність амінокислот
1020304050
MTAESGPPPPQPEVLATVKEERGETAAGAGVPGEATGRGAGGRRRKRPLQ
RGKPPYSYIALIAMAIAHAPERRLTLGGIYKFITERFPFYRDNPKKWQNS
IRHNLTLNDCFLKIPREAGRPGKGNYWALDPNAEDMFESGSFLRRRKRFK
RSDLSTYPAYMHDAAAAAAAAAAAAAAAAIFPGAVPAARPPYPGAVYAGY
APPSLAAPPPVYYPAASPGPCRVFGLVPERPLSPELGPAPSGPGGSCAFA
SAGAPATTTGYQPAGCTGARPANPSAYAAAYAGPDGAYPQGAGSAIFAAA
GRLAGPASPPAGGSSGGVETTVDFYGRTSPGQFGALGACYNPGGQLGGAS
AGAYHARHAAAYPGGIDRFVSAM

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Chadwick B.P., Obermayr F., Frischauf A.-M. (1997). FKHL15, a new human member of the forkhead gene family located on chromosome 9q22.. Genomics 41: 390 — 396.  PubMed DOI:10.1006/geno.1997.4692
  • Macchia P.E., Mattei M.-G., Lapi P., Fenzi G., Di Lauro R. (1999). Cloning, chromosomal localization and identification of polymorphisms in the human thyroid transcription factor 2 gene (TITF2).. Biochimie 81: 433 — 440.  PubMed DOI:10.1016/S0300-9084(99)80092-3
  • Kang I.N., Musa M., Harun F., Junit S.M. (2010). Characterization of mutations in the FOXE1 gene in a cohort of unrelated Malaysian patients with congenital hypothyroidism and thyroid dysgenesis.. Biochem. Genet. 48: 141 — 151.  PubMed DOI:10.1007/s10528-009-9306-7

Примітки[ред. | ред. код]

  1. HUGO Gene Nomenclature Commitee, HGNC:3806 (англ.). Процитовано 7 вересня 2017. 
  2. UniProt, O00358 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]