ATF2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ATF2
Protein ATF2 PDB 1bhi.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ATF2, CRE-BP1, CREB-2, CREB2, HB16, TREB7, activating transcription factor 2
Зовнішні ІД OMIM: 123811 MGI: 109349 HomoloGene: 31061 GeneCards: ATF2
Шаблон експресії
PBB GE ATF2 212984 at fs.png

PBB GE ATF2 205446 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 2: 175.07 – 175.17 Mb Хр. 2: 73.82 – 73.89 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ATF2 (англ. Activating transcription factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 2-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 505 амінокислот, а молекулярна маса — 54 537[4].

Послідовність амінокислот
1020304050
MKFKLHVNSARQYKDLWNMSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHE
MTLKFGPARNDSVIVADQTPTPTRFLKNCEEVGLFNELASPFENEFKKAS
EDDIKKMPLDLSPLATPIIRSKIEEPSVVETTHQDSPLPHPESTTSDEKE
VPLAQTAQPTSAIVRPASLQVPNVLLTSSDSSVIIQQAVPSPTSSTVITQ
APSSNRPIVPVPGPFPLLLHLPNGQTMPVAIPASITSSNVHVPAAVPLVR
PVTMVPSVPGIPGPSSPQPVQSEAKMRLKAALTQQHPPVTNGDTVKGHGS
GLVRTQSEESRPQSLQQPATSTTETPASPAHTTPQTQSTSGRRRRAANED
PDEKRRKFLERNRAAASRCRQKRKVWVQSLEKKAEDLSSLNGQLQSEVTL
LRNEVAQLKQLLLAHKDCPVTAMQKKSGYHTADKDDSSEDISVPSSPHTE
AIQHSSVSTSNGVSSTSKAEAVATSVLTQMADQSTEPALSQIVMAPSSQS
QPSGS

Кодований геном білок за функціями належить до трансфераз, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, пошкодження ДНК, поліморфізм, ацетиляція, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у цитоплазмі, ядрі, мембрані, мітохондрії, зовнішній мембрані мітохондрій.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kara C.J., Liou H.-C., Ivashkiv L.B., Glimcher L.H. (1990). A cDNA for a human cyclic AMP response element-binding protein which is distinct from CREB and expressed preferentially in brain.. Mol. Cell. Biol. 10: 1347 — 1357.  PubMed DOI:10.1128/MCB.10.4.1347
  • Enslen H., Tokumitsu H., Stork P.J., Davis R.J., Soderling T.R. (1996). Regulation of mitogen-activated protein kinases by a calcium/calmodulin-dependent protein kinase cascade.. Proc. Natl. Acad. Sci. U.S.A. 93: 10803 — 10808.  PubMed DOI:10.1073/pnas.93.20.10803
  • Enslen H., Raingeaud J., Davis R.J. (1998). Selective activation of p38 mitogen-activated protein (MAP) kinase isoforms by the MAP kinase kinases MKK3 and MKK6.. J. Biol. Chem. 273: 1741 — 1748.  PubMed DOI:10.1074/jbc.273.3.1741
  • Sevilla A., Santos C.R., Vega F.M., Lazo P.A. (2004). Human vaccinia-related kinase 1 (VRK1) activates the ATF2 transcriptional activity by novel phosphorylation on Thr-73 and Ser-62 and cooperates with JNK.. J. Biol. Chem. 279: 27458 — 27465.  PubMed DOI:10.1074/jbc.M401009200
  • Bhoumik A., Ronai Z. (2008). ATF2: a transcription factor that elicits oncogenic or tumor suppressor activities.. Cell Cycle 7: 2341 — 2345.  PubMed DOI:10.4161/cc.6388

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:784 (англ.). Процитовано 28 серпня 2017. 
  4. UniProt, P15336 (англ.). Процитовано 28 серпня 2017. 

Див. також[ред. | ред. код]