STAT2

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
STAT2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи STAT2, ISGF-3, P113, STAT113, IMD44, signal transducer and activator of transcription 2
Зовнішні ІД OMIM: 600556 MGI: 103039 HomoloGene: 3952 GeneCards: STAT2
Шаблон експресії
PBB GE STAT2 205170 at fs.png

PBB GE STAT2 217199 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005419
NM_198332
NM_019963
RefSeq (білок)
NP_005410
NP_938146
н/д
Локус (UCSC) Хр. 12: 56.34 – 56.36 Mb Хр. 10: 128.27 – 128.29 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STAT2 (англ. Signal transducer and activator of transcription 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 851 амінокислот, а молекулярна маса — 97 916[4].

Послідовність амінокислот
1020304050
MAQWEMLQNLDSPFQDQLHQLYSHSLLPVDIRQYLAVWIEDQNWQEAALG
SDDSKATMLFFHFLDQLNYECGRCSQDPESLLLQHNLRKFCRDIQPFSQD
PTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRIL
DLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQ
ETLNELDKRRKEVLDASKALLGRLTTLIELLLPKLEEWKAQQQKACIRAP
IDHGLEQLETWFTAGAKLLFHLRQLLKELKGLSCLVSYQDDPLTKGVDLR
NAQVTELLQRLLHRAFVVETQPCMPQTPHRPLILKTGSKFTVRTRLLVRL
QEGNESLTVEVSIDRNPPQLQGFRKFNILTSNQKTLTPEKGQSQGLIWDF
GYLTLVEQRSGGSGKGSNKGPLGVTEELHIISFTVKYTYQGLKQELKTDT
LPVVIISNMNQLSIAWASVLWFNLLSPNLQNQQFFSNPPKAPWSLLGPAL
SWQFSSYVGRGLNSDQLSMLRNKLFGQNCRTEDPLLSWADFTKRESPPGK
LPFWTWLDKILELVHDHLKDLWNDGRIMGFVSRSQERRLLKKTMSGTFLL
RFSESSEGGITCSWVEHQDDDKVLIYSVQPYTKEVLQSLPLTEIIRHYQL
LTEENIPENPLRFLYPRIPRDEAFGCYYQEKVNLQERRKYLKHRLIVVSN
RQVDELQQPLELKPEPELESLELELGLVPEPELSLDLEPLLKAGLDLGPE
LESVLESTLEPVIEPTLCMVSQTVPEPDQGPVSQPVPEPDLPCDLRHLNT
EPMEIFRNCVKIEEIMPNGDPLLAGQNTVDEVYVSRPSHFYTDGPLMPSD
F

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як взаємодія хазяїн-вірус, транскрипція, регуляція транскрипції, противірусний захист, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Fu X.-Y., Schindler C., Improta T., Aebersold R., Darnell J.E. Jr. (1992). The proteins of ISGF-3, the interferon alpha-induced transcriptional activator, define a gene family involved in signal transduction.. Proc. Natl. Acad. Sci. U.S.A. 89: 7840 — 7843.  PubMed DOI:10.1073/pnas.89.16.7840
  • Yan R., Qureshi S., Zhong Z., Wen Z., Darnell J.E. Jr. (1995). The genomic structure of the STAT genes: multiple exons in coincident sites in Stat1 and Stat2.. Nucleic Acids Res. 23: 459 — 463.  PubMed DOI:10.1093/nar/23.3.459
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Fu X.Y. (1992). A transcription factor with SH2 and SH3 domains is directly activated by an interferon alpha-induced cytoplasmic protein tyrosine kinase(s).. Cell 70: 323 — 335.  PubMed DOI:10.1016/0092-8674(92)90106-M
  • Leung S., Qureshi S.A., Kerr I.M., Darnell J.E. Jr., Stark G.R. (1995). Role of STAT2 in the alpha interferon signaling pathway.. Mol. Cell. Biol. 15: 1312 — 1317.  PubMed DOI:10.1128/MCB.15.3.1312
  • Sugiyama T., Nishio Y., Kishimoto T., Akira S. (1996). Identification of alternative splicing form of Stat2.. FEBS Lett. 381: 191 — 194.  PubMed DOI:10.1016/0014-5793(96)00121-4

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11363 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P52630 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]