ZNF300

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF300
Ідентифікатори
Символи ZNF300, zinc finger protein 300
Зовнішні ІД OMIM: 612429 HomoloGene: 56531 GeneCards: ZNF300
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001172831
NM_001172832
NM_052860
н/д
RefSeq (білок)
NP_001166302
NP_001166303
NP_443092
н/д
Локус (UCSC) Хр. 5: 150.89 – 150.9 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ZNF300 (англ. Zinc finger protein 300) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 604 амінокислот, а молекулярна маса — 68 743[3].

Послідовність амінокислот
1020304050
MMKSQGLVSFKDVAVDFTQEEWQQLDPSQRTLYRDVMLENYSHLVSMGYP
VSKPDVISKLEQGEEPWIIKGDISNWIYPDEYQADGRQDRKSNLHNSQSC
ILGTVSFHHKILKGVTRDGSLCSILKVCQGDGQLQRFLENQDKLFRQVTF
VNSKTVTEASGHKYNPLGKIFQECIETDISIQRFHKYDAFKKNLKPNIDL
PSCYKSNSRKKPDQSFGGGKSSSQSEPNSNLEKIHNGVIPFDDNQCGNVF
RNTQSLIQYQNVETKEKSCVCVTCGKAFAKKSQLIVHQRIHTGKKPYDCG
ACGKAFSEKFHLVVHQRTHTGEKPYDCSECGKAFSQKSSLIIHQRVHTGE
KPYECSECGKAFSQKSPLIIHQRIHTGEKPYECRECGKAFSQKSQLIIHH
RAHTGEKPYECTECGKAFCEKSHLIIHKRIHTGEKPYKCAQCEEAFSRKT
ELITHQLVHTGEKPYECTECGKTFSRKSQLIIHQRTHTGEKPYKCSECGK
AFCQKSHLIGHQRIHTGEKPYICTECGKAFSQKSHLPGHQRIHTGEKPYI
CAECGKAFSQKSDLVLHQRIHTGERPYQCAICGKAFIQKSQLTVHQRIHT
VVKS

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Cao Y., Li J.-X., Ji C.-N., Xu X.-W., Wu M. (2007). Molecular cloning and characterization of a novel splice variant of human ZNF300 gene, which expressed highly in testis.. DNA Seq. 18: 312 — 315.  PubMed DOI:10.1080/10425170701243393
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:13091 (англ.). Процитовано 5 вересня 2017. 
  3. UniProt, Q96RE9 (англ.). Процитовано 5 вересня 2017. 

Див. також[ред. | ред. код]