ZBTB18

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZBTB18
Ідентифікатори
Символи ZBTB18, C2H2-171, MRD22, RP58, TAZ-1, ZNF238, zinc finger and BTB domain containing 18
Зовнішні ІД OMIM: 608433 MGI: 1353609 HomoloGene: 21276 GeneCards: ZBTB18
Пов'язані генетичні захворювання
autosomal dominant non-syndromic intellectual disability 22[1]
Шаблон експресії
PBB GE ZNF238 207164 s at fs.png

PBB GE ZNF238 212774 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001278196
NM_006352
NM_205768
RefSeq (білок)
NP_001265125
NP_006343
NP_991331
Локус (UCSC) Хр. 1: 244.05 – 244.06 Mb Хр. 1: 177.44 – 177.45 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ZBTB18 (англ. Zinc finger and BTB domain containing 18) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 1-ї хромосоми. [4] Довжина поліпептидного ланцюга білка становить 522 амінокислот, а молекулярна маса — 58 354[5].

Послідовність амінокислот
1020304050
MEFPDHSRHLLQCLSEQRHQGFLCDCTVLVGDAQFRAHRAVLASCSMYFH
LFYKDQLDKRDIVHLNSDIVTAPAFALLLEFMYEGKLQFKDLPIEDVLAA
ASYLHMYDIVKVCKKKLKEKATTEADSTKKEEDASSCSDKVESLSDGSSH
IAGDLPSDEDEGEDEKLNILPSKRDLAAEPGNMWMRLPSDSAGIPQAGGE
AEPHATAAGKTVASPCSSTESLSQRSVTSVRDSADVDCVLDLSVKSSLSG
VENLNSSYFSSQDVLRSNLVQVKVEKEASCDESDVGTNDYDMEHSTVKES
VSTNNRVQYEPAHLAPLREDSVLRELDREDKASDDEMMTPESERVQVEGG
MESSLLPYVSNILSPAGQIFMCPLCNKVFPSPHILQIHLSTHFREQDGIR
SKPAADVNVPTCSLCGKTFSCMYTLKRHERTHSGEKPYTCTQCGKSFQYS
HNLSRHAVVHTREKPHACKWCERRFTQSGDLYRHIRKFHCELVNSLSVKS
EALSLPTVRDWTLEDSSQELWK

Кодований геном білок за функціями належить до репресорів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Adams M.D., Kerlavage A.R., Fields C., Venter J.C. (1993). 3,400 new expressed sequence tags identify diversity of transcripts in human brain.. Nat. Genet. 4: 256 — 267.  PubMed DOI:10.1038/ng0793-256
  • Fuks F., Burgers W.A., Godin N., Kasai M., Kouzarides T. (2001). Dnmt3a binds deacetylases and is recruited by a sequence-specific repressor to silence transcription.. EMBO J. 20: 2536 — 2544.  PubMed DOI:10.1093/emboj/20.10.2536

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]