KDM5A

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
KDM5A
Protein KDM5A PDB 2JXJ.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи KDM5A, RBBP-2, RBBP2, RBP2, JARID1A, lysine demethylase 5A
Зовнішні ІД OMIM: 180202 MGI: 2136980 HomoloGene: 3419 GeneCards: KDM5A
Шаблон експресії
PBB GE JARID1A 215698 at fs.png

PBB GE JARID1A 202040 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005056
NM_001042603
NM_145997
RefSeq (білок)
NP_001036068
NP_666109
Локус (UCSC) Хр. 12: 0.28 – 0.39 Mb Хр. 6: 120.36 – 120.44 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

KDM5A (англ. Lysine demethylase 5A) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 12-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 1 690 амінокислот, а молекулярна маса — 192 095[4].

Послідовність амінокислот
1020304050
MAGVGPGGYAAEFVPPPECPVFEPSWEEFTDPLSFIGRIRPLAEKTGICK
IRPPKDWQPPFACEVKSFRFTPRVQRLNELEAMTRVRLDFLDQLAKFWEL
QGSTLKIPVVERKILDLYALSKIVASKGGFEMVTKEKKWSKVGSRLGYLP
GKGTGSLLKSHYERILYPYELFQSGVSLMGVQMPNLDLKEKVEPEVLSTD
TQTSPEPGTRMNILPKRTRRVKTQSESGDVSRNTELKKLQIFGAGPKVVG
LAMGTKDKEDEVTRRRKVTNRSDAFNMQMRQRKGTLSVNFVDLYVCMFCG
RGNNEDKLLLCDGCDDSYHTFCLIPPLPDVPKGDWRCPKCVAEECSKPRE
AFGFEQAVREYTLQSFGEMADNFKSDYFNMPVHMVPTELVEKEFWRLVSS
IEEDVIVEYGADISSKDFGSGFPVKDGRRKILPEEEEYALSGWNLNNMPV
LEQSVLAHINVDISGMKVPWLYVGMCFSSFCWHIEDHWSYSINYLHWGEP
KTWYGVPSHAAEQLEEVMRELAPELFESQPDLLHQLVTIMNPNVLMEHGV
PVYRTNQCAGEFVVTFPRAYHSGFNQGYNFAEAVNFCTADWLPIGRQCVN
HYRRLRRHCVFSHEELIFKMAADPECLDVGLAAMVCKELTLMTEEETRLR
ESVVQMGVLMSEEEVFELVPDDERQCSACRTTCFLSALTCSCNPERLVCL
YHPTDLCPCPMQKKCLRYRYPLEDLPSLLYGVKVRAQSYDTWVSRVTEAL
SANFNHKKDLIELRVMLEDAEDRKYPENDLFRKLRDAVKEAETCASVAQL
LLSKKQKHRQSPDSGRTRTKLTVEELKAFVQQLFSLPCVISQARQVKNLL
DDVEEFHERAQEAMMDETPDSSKLQMLIDMGSSLYVELPELPRLKQELQQ
ARWLDEVRLTLSDPQQVTLDVMKKLIDSGVGLAPHHAVEKAMAELQELLT
VSERWEEKAKVCLQARPRHSVASLESIVNEAKNIPAFLPNVLSLKEALQK
AREWTAKVEAIQSGSNYAYLEQLESLSAKGRPIPVRLEALPQVESQVAAA
RAWRERTGRTFLKKNSSHTLLQVLSPRTDIGVYGSGKNRRKKVKELIEKE
KEKDLDLEPLSDLEEGLEETRDTAMVVAVFKEREQKEIEAMHSLRAANLA
KMTMVDRIEEVKFCICRKTASGFMLQCELCKDWFHNSCVPLPKSSSQKKG
SSWQAKEVKFLCPLCMRSRRPRLETILSLLVSLQKLPVRLPEGEALQCLT
ERAMSWQDRARQALATDELSSALAKLSVLSQRMVEQAAREKTEKIISAEL
QKAAANPDLQGHLPSFQQSAFNRVVSSVSSSPRQTMDYDDEETDSDEDIR
ETYGYDMKDTASVKSSSSLEPNLFCDEEIPIKSEEVVTHMWTAPSFCAEH
AYSSASKSCSQGSSTPRKQPRKSPLVPRSLEPPVLELSPGAKAQLEELMM
VGDLLEVSLDETQHIWRILQATHPPSEDRFLHIMEDDSMEEKPLKVKGKD
SSEKKRKRKLEKVEQLFGEGKQKSKELKKMDKPRKKKLKLGADKSKELNK
LAKKLAKEEERKKKKEKAAAAKVELVKESTEKKREKKVLDIPSKYDWSGA
EESDDENAVCAAQNCQRPCKDKVDWVQCDGGCDEWFHQVCVGVSPEMAEN
EDYICINCAKKQGPVSPGPAPPPSFIMSYKLPMEDLKETS

Кодований геном білок за функціями належить до оксидоредуктаз, активаторів, регуляторів хроматину, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, іоном заліза. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Kim Y.W., Otterson G.A., Kratzke R.A., Coxon A.B., Kaye F.J. (1994). Differential specificity for binding of retinoblastoma binding protein 2 to RB, p107, and TATA-binding protein.. Mol. Cell. Biol. 14: 7256 — 7264.  PubMed DOI:10.1128/MCB.14.11.7256
  • Mao S., Neale G.A.M., Goorha R.M. (1997). T-cell oncogene rhombotin-2 interacts with retinoblastoma-binding protein 2.. Oncogene 14: 1531 — 1539.  PubMed DOI:10.1038/sj.onc.1200988
  • Chan S.W., Hong W. (2001). Retinoblastoma-binding protein 2 (Rbp2) potentiates nuclear hormone receptor-mediated transcription.. J. Biol. Chem. 276: 28402 — 28412.  PubMed DOI:10.1074/jbc.M100313200
  • Benevolenskaya E.V., Murray H.L., Branton P., Young R.A., Kaelin W.G. Jr. (2005). Binding of pRB to the PHD protein RBP2 promotes cellular differentiation.. Mol. Cell 18: 623 — 635.  PubMed DOI:10.1016/j.molcel.2005.05.012
  • Secombe J., Li L., Carlos L., Eisenman R.N. (2007). The Trithorax group protein Lid is a trimethyl histone H3K4 demethylase required for dMyc-induced cell growth.. Genes Dev. 21: 537 — 551.  PubMed DOI:10.1101/gad.1523007

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:9886 (англ.). Процитовано 11 вересня 2017. 
  4. UniProt, P29375 (англ.). Процитовано 11 вересня 2017. 

Див. також[ред. | ред. код]