HLF

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HLF
Ідентифікатори
Символи HLF, PAR bZIP transcription factor, HLF transcription factor, PAR bZIP family member
Зовнішні ІД OMIM: 142385 MGI: 96108 HomoloGene: 31074 GeneCards: HLF
Шаблон експресії
PBB GE HLF 204754 at fs.png

PBB GE HLF 204753 s at fs.png

PBB GE HLF 204755 x at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002126
NM_001330375
NM_172563
RefSeq (білок)
NP_001317304
NP_002117
NP_766151
Локус (UCSC) Хр. 17: 55.26 – 55.33 Mb Хр. 11: 90.34 – 90.39 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HLF (англ. HLF, PAR bZIP transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 295 амінокислот, а молекулярна маса — 33 199[4].

Послідовність амінокислот
1020304050
MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKL
DDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPS
PSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRP
GQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKF
SEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKE
NQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Hunger S.P., Ohyashiki K., Toyama K., Cleary M.L. (1992). Hlf, a novel hepatic bZIP protein, shows altered DNA-binding properties following fusion to E2A in t(17;19) acute lymphoblastic leukemia.. Genes Dev. 6: 1608 — 1620.  PubMed DOI:10.1101/gad.6.9.1608
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:4977 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, Q16534 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]