NR2F1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR2F1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR2F1, BBOAS, BBSOAS, COUP-TFI, EAR-3, EAR3, ERBAL3, NR2F2, SVP44, TCFCOUP1, TFCOUP1, nuclear receptor subfamily 2 group F member 1, COUPTF1
Зовнішні ІД OMIM: 132890 MGI: 1352451 HomoloGene: 21158 GeneCards: NR2F1
Шаблон експресії
PBB GE NR2F1 209505 at fs.png

PBB GE NR2F1 209506 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005654
NM_010151
NM_001347538
NM_001347539
RefSeq (білок)
NP_005645
NP_001334467
NP_001334468
NP_034281
Локус (UCSC) Хр. 5: 93.58 – 93.59 Mb Хр. 13: 78.19 – 78.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR2F1 (англ. Nuclear receptor subfamily 2 group F member 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 423 амінокислот, а молекулярна маса — 46 156[4].

Послідовність амінокислот
1020304050
MAMVVSSWRDPQDDVAGGNPGGPNPAAQAARGGGGGAGEQQQQAGSGAPH
TPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVVCGDKSSGKHYGQ
FTCEGCKSFFKRSVRRNLTYTCRANRNCPIDQHHRNQCQYCRLKKCLKVG
MRREAVQRGRMPPTQPNPGQYALTNGDPLNGHCYLSGYISLLLRAEPYPT
SRYGSQCMQPNNIMGIENICELAARLLFSAVEWARNIPFFPDLQITDQVS
LLRLTWSELFVLNAAQCSMPLHVAPLLAAAGLHASPMSADRVVAFMDHIR
IFQEQVEKLKALHVDSAEYSCLKAIVLFTSDACGLSDAAHIESLQEKSQC
ALEEYVRSQYPNQPSRFGKLLLRLPSLRTVSSSVIEQLFFVRLVGKTPIE
TLIRDMLLSGSSFNWPYMSIQCS

Кодований геном білок за функціями належить до репресорів, рецепторів, активаторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Zhang Y., Dufau M.L. (2000). Nuclear orphan receptors regulate transcription of the gene for the human luteinizing hormone receptor.. J. Biol. Chem. 275: 2763 — 2770.  PubMed DOI:10.1074/jbc.275.4.2763
  • Zhang Y., Dufau M.L. (2001). EAR2 and EAR3/COUP-TFI regulate transcription of the rat LH receptor.. Mol. Endocrinol. 15: 1891 — 1905.  PubMed DOI:10.1210/mend.15.11.0720

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7975 (англ.). Процитовано 5 вересня 2017. 
  4. UniProt, P10589 (англ.). Процитовано 5 вересня 2017. 

Див. також[ред. | ред. код]