IRF1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
IRF1
Protein IRF1 PDB 1if1.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи IRF1, IRF-1, MAR, interferon regulatory factor 1
Зовнішні ІД OMIM: 147575 MGI: 96590 HomoloGene: 1658 GeneCards: IRF1
Шаблон експресії
PBB GE IRF1 202531 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_002198
NM_001159393
NM_001159396
NM_008390
RefSeq (білок)
NP_002189
NP_001341853
NP_001341854
NP_001152865
NP_001152868
NP_032416
Локус (UCSC) н/д Хр. 11: 53.77 – 53.78 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

IRF1 (англ. Interferon regulatory factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 325 амінокислот, а молекулярна маса — 36 502[4].

Послідовність амінокислот
1020304050
MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINK
DACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRN
KGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSD
GLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVE
VVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTN
VDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKN
MDATWLDSLLTPVRLPSIQAIPCAP

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах як імунітет, вроджений імунітет, транскрипція, регуляція транскрипції, антивірусний захист, ацетилювання. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Maruyama M., Fujita T., Taniguchi T. (1989). Sequence of a cDNA coding for human IRF-1.. Nucleic Acids Res. 17: 3292 — 3292.  PubMed DOI:10.1093/nar/17.8.3292
  • Cha Y., Sims S.H., Romine M.F., Kaufmann M., Deisseroth A.B. (1992). Human interferon regulatory factor 1: intron-exon organization.. DNA Cell Biol. 11: 605 — 611.  PubMed DOI:10.1089/dna.1992.11.605
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Lin R., Hiscott J. (1999). A role for casein kinase II phosphorylation in the regulation of IRF-1 transcriptional activity.. Mol. Cell. Biochem. 191: 169 — 180.  PubMed DOI:10.1023/A:1006850009017
  • Taniguchi T., Ogasawara K., Takaoka A., Tanaka N. (2001). IRF family of transcription factors as regulators of host defense.. Annu. Rev. Immunol. 19: 623 — 655.  PubMed DOI:10.1146/annurev.immunol.19.1.623
  • Kroeger A., Koester M., Schroeder K., Hauser H., Mueller P.P. (2002). Activities of IRF-1.. J. Interferon Cytokine Res. 22: 5 — 14.  PubMed DOI:10.1089/107999002753452610

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:6116 (англ.). Процитовано 31 серпня 2017. 
  4. UniProt, P10914 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]