FOSB

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOSB
Ідентифікатори
Символи FOSB, AP-1, G0S3, GOS3, GOSB, FosB, ΔFosB, FosB proto-oncogene, AP-1 transcription factor subunit
Зовнішні ІД OMIM: 164772 MGI: 95575 HomoloGene: 31403 GeneCards: FOSB
Шаблон експресії
PBB GE FOSB 202768 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001114171
NM_006732
NM_008036
NM_001347586
RefSeq (білок)
NP_001107643
NP_006723
NP_001334515
NP_032062
Локус (UCSC) Хр. 19: 45.47 – 45.48 Mb Хр. 7: 19.3 – 19.31 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOSB (англ. FosB proto-oncogene, AP-1 transcription factor subunit) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 19-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 338 амінокислот, а молекулярна маса — 35 928[4].

Послідовність амінокислот
1020304050
MFQAFPGDYDSGSRCSSSPSAESQYLSSVDSFGSPPTAAASQECAGLGEM
PGSFVPTVTAITTSQDLQWLVQPTLISSMAQSQGQPLASQPPVVDPYDMP
GTSYSTPGMSGYSSGGASGSGGPSTSGTTSGPGPARPARARPRRPREETL
TPEEEEKRRVRRERNKLAAAKCRNRRRELTDRLQAETDQLEEEKAELESE
IAELQKEKERLEFVLVAHKPGCKIPYEEGPGPGPLAEVRDLPGSAPAKED
GFSWLLPPPPPPPLPFQTSQDAPPNLTASLFTHSEVQVLGDPFPVVNPSY
TSSFVLTCPEVSAFAGAQRTSGSDQPSDPLNSPSLLAL

Задіяний у такому біологічному процесі, як альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Heximer S.P., Cristillo A.D., Russell L., Forsdyke D.R. (1996). Sequence analysis and expression in cultured lymphocytes of the human FOSB gene (G0S3).. DNA Cell Biol. 15: 1025 — 1038.  PubMed DOI:10.1089/dna.1996.15.1025
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3797 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P53539 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]