STAT5B

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
STAT5B
Protein STAT5B PDB 1y1u.png
Ідентифікатори
Символи STAT5B, STAT5, signal transducer and activator of transcription 5B
Зовнішні ІД OMIM: 604260 MGI: 103035 HomoloGene: 55718 GeneCards: STAT5B
Шаблон експресії
PBB GE STAT5B 212550 at fs.png

PBB GE STAT5B 205026 at fs.png

PBB GE STAT5B 212549 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012448
NM_001113563
NM_011489
NM_001362682
RefSeq (білок)
NP_036580
NP_001107035
NP_035619
NP_001349611
Локус (UCSC) Хр. 17: 42.2 – 42.28 Mb Хр. 11: 100.78 – 100.85 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

STAT5B (англ. Signal transducer and activator of transcription 5B) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 17-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 787 амінокислот, а молекулярна маса — 89 866[4].

Послідовність амінокислот
1020304050
MAVWIQAQQLQGEALHQMQALYGQHFPIEVRHYLSQWIESQAWDSVDLDN
PQENIKATQLLEGLVQELQKKAEHQVGEDGFLLKIKLGHYATQLQNTYDR
CPMELVRCIRHILYNEQRLVREANNGSSPAGSLADAMSQKHLQINQTFEE
LRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFGPLAQLSPQERLSR
ETALQQKQVSLEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDD
ELIQWKRRQQLAGNGGPPEGSLDVLQSWCEKLAEIIWQNRQQIRRAEHLC
QQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNDYSGEILNNC
CVMEYHQATGTLSAHFRNMSLKRIKRSDRRGAESVTEEKFTILFESQFSV
GGNELVFQVKTLSLPVVVIVHGSQDNNATATVLWDNAFAEPGRVPFAVPD
KVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSG
LSVSWSQFNRENLPGRNYTFWQWFDGVMEVLKKHLKPHWNDGAILGFVNK
QQAHDLLINKPDGTFLLRFSDSEIGGITIAWKFDSQERMFWNLMPFTTRD
FSIRSLADRLGDLNYLIYVFPDRPKDEVYSKYYTPVPCESATAKAVDGYV
KPQIKQVVPEFVNASADAGGGSATYMDQAPSPAVCPQAHYNMYPQNPDSV
LDTDGDFDLEDTMDVARRVEELLGRPMDSQWIPHAQS

Кодований геном білок за функціями належить до активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Silva C.M., Lu H., Day R.N. (1996). Characterization and cloning of STAT5 from IM-9 cells and its activation by growth hormone.. Mol. Endocrinol. 10: 508 — 518.  PubMed DOI:10.1210/mend.10.5.8732682
  • Lin J.-X., Mietz J., Modi W.S., John S., Leonard W.J. (1996). Cloning of human Stat5B. Reconstitution of interleukin-2-induced Stat5A and Stat5B DNA binding activity in COS-7 cells.. J. Biol. Chem. 271: 10738 — 10744.  PubMed DOI:10.1074/jbc.271.18.10690
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Sawka-Verhelle D., Filloux C., Tartare-Deckert S., Mothe I., Van Obberghen E. (1997). Identification of Stat 5B as a substrate of the insulin receptor.. Eur. J. Biochem. 250: 411 — 417.  PubMed DOI:10.1111/j.1432-1033.1997.0411a.x
  • Zhu M.-H., John S., Berg M., Leonard W.J. (1999). Functional association of Nmi with Stat5 and Stat1 in IL-2- and IFNgamma-mediated signaling.. Cell 96: 121 — 130.  PubMed DOI:10.1016/S0092-8674(00)80965-4
  • Aoki N., Matsuda T. (2002). A nuclear protein tyrosine phosphatase TC-PTP is a potential negative regulator of the PRL-mediated signaling pathway: dephosphorylation and deactivation of signal transducer and activator of transcription 5a and 5b by TC-PTP in nucleus.. Mol. Endocrinol. 16: 58 — 69.  PubMed DOI:10.1210/mend.16.1.0761

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11367 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P51692 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]