ERG

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ERG
Protein ERG PDB 1fli.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ERG, erg-3, p55, ETS-related gene, v-ets avian erythroblastosis virus E26 oncogene homolog, ETS transcription factor, ETS transcription factor ERG
Зовнішні ІД OMIM: 165080 MGI: 95415 HomoloGene: 15848 GeneCards: ERG
Шаблон експресії
PBB GE ERG 222079 at fs.png

PBB GE ERG 211626 x at fs.png

PBB GE ERG 213541 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
RefSeq (білок)
Локус (UCSC) Хр. 21: 38.38 – 38.66 Mb Хр. 16: 95.36 – 95.59 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ERG (англ. ERG, ETS transcription factor) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 21-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 486 амінокислот, а молекулярна маса — 54 608[4].

Послідовність амінокислот
1020304050
MIQTVPDPAAHIKEALSVVSEDQSLFECAYGTPHLAKTEMTASSSSDYGQ
TSKMSPRVPQQDWLSQPPARVTIKMECNPSQVNGSRNSPDECSVAKGGKM
VGSPDTVGMNYGSYMEEKHMPPPNMTTNERRVIVPADPTLWSTDHVRQWL
EWAVKEYGLPDVNILLFQNIDGKELCKMTKDDFQRLTPSYNADILLSHLH
YLRETPLPHLTSDDVDKALQNSPRLMHARNTGGAAFIFPNTSVYPEATQR
ITTRPDLPYEPPRRSAWTGHGHPTPQSKAAQPSPSTVPKTEDQRPQLDPY
QILGPTSSRLANPGSGQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTD
PDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFH
GIAQALQPHPPESSLYKYPSDLPYMGSYHAHPQKMNFVAPHPPALPVTSS
SFFAAPNPYWNSPTGGIYPNTRLPTSHMPSHLGTYY

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • Rao V.N., Papas T.S., Shyam E., Reddy P. (1987). erg, a human ets-related gene on chromosome 21: alternative splicing, polyadenylation, and translation.. Science 237: 635 — 639.  PubMed DOI:10.1126/science.3299708
  • Reddy E.S.P., Rao V.N., Papas T.S. (1987). The erg gene: a human gene related to the ets oncogene.. Proc. Natl. Acad. Sci. U.S.A. 84: 6131 — 6135.  PubMed DOI:10.1073/pnas.84.17.6131
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Dunn T., Praissman L., Hagag N., Viola M.V. (1994). ERG gene is translocated in an Ewing's sarcoma cell line.. Cancer Genet. Cytogenet. 76: 19 — 22.  PubMed DOI:10.1016/0165-4608(94)90063-9
  • Prasad D.D., Rao V.N., Lee L., Reddy E.S. (1994). Differentially spliced erg-3 product functions as a transcriptional activator.. Oncogene 9: 669 — 673.  PubMed
  • Ichikawa H., Shimizu K., Hayashi Y., Ohki M. (1994). An RNA-binding protein gene, TLS/FUS, is fused to ERG in human myeloid leukemia with t(16;21) chromosomal translocation.. Cancer Res. 54: 2865 — 2868.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3446 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P11308 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]