SSRP1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
SSRP1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи SSRP1, FACT, FACT80, T160, Structure specific recognition protein 1
Зовнішні ІД OMIM: 604328 MGI: 107912 HomoloGene: 110735 GeneCards: SSRP1
Шаблон експресії
PBB GE SSRP1 200957 s at fs.png

PBB GE SSRP1 200956 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_003146
NM_001136081
NM_182990
RefSeq (білок)
NP_003137
NP_001129553
NP_892035
Локус (UCSC) Хр. 11: 57.33 – 57.34 Mb Хр. 2: 85.04 – 85.05 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

SSRP1 (англ. Structure specific recognition protein 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 709 амінокислот, а молекулярна маса — 81 075[4].

Послідовність амінокислот
1020304050
MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTE
GIWRRVALGHGLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEK
DLCVKGWNWGTVKFGGQLLSFDIGDQPVFEIPLSNVSQCTTGKNEVTLEF
HQNDDAEVSLMEVRFYVPPTQEDGVDPVEAFAQNVLSKADVIQATGDAIC
IFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVLRLFLLPHKDQ
RQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEG
RLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSG
LLYPLERGFIYVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQ
YTFSSIEREEYGKLFDFVNAKKLNIKNRGLKEGMNPSYDEYADSDEDQHD
AYLERMKEEGKIREENANDSSDDSGEETDESFNPGEEEEDVAEEFDSNAS
ASSSSNEGDSDRDEKKRKQLKKAKMAKDRKSRKKPVEVKKGKDPNAPKRP
MSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKA
EDARRDYEKAMKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSK
SSSRQLSESFKSKEFVSSDESSSGENKSKKKRRRSEDSEEEELASTPPSS
EDSASGSDE

Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, пошкодження ДНК, репарація ДНК, реплікація ДНК. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі, хромосомах.

Література[ред. | ред. код]

  • Bruhn S.L., Pil P.M., Essigmann J.M., Housman D.E., Lippard S.J. (1992). Isolation and characterization of human cDNA clones encoding a high mobility group box protein that recognizes structural distortions to DNA caused by binding of the anticancer agent cisplatin.. Proc. Natl. Acad. Sci. U.S.A. 89: 2307 — 2311.  PubMed DOI:10.1073/pnas.89.6.2307
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Orphanides G., LeRoy G., Chang C.-H., Luse D.S., Reinberg D. (1998). FACT, a factor that facilitates transcript elongation through nucleosomes.. Cell 92: 105 — 116.  PubMed DOI:10.1016/S0092-8674(00)80903-4
  • Dyer M.A., Hayes P.J., Baron M.H. (1998). The HMG domain protein SSRP1/PREIIBF is involved in activation of the human embryonic beta-like globin gene.. Mol. Cell. Biol. 18: 2617 — 2628.  PubMed DOI:10.1128/MCB.18.5.2617
  • LeRoy G., Orphanides G., Lane W.S., Reinberg D. (1998). Requirement of RSF and FACT for transcription of chromatin templates in vitro.. Science 282: 1900 — 1904.  PubMed DOI:10.1126/science.282.5395.1900
  • Orphanides G., Wu W.-H., Lane W.S., Hampsey M., Reinberg D. (1999). The chromatin-specific transcription elongation factor FACT comprises human SPT16 and SSRP1 proteins.. Nature 400: 284 — 288.  PubMed DOI:10.1038/22350

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11327 (англ.). Процитовано 21 серпня 2017. 
  4. UniProt, Q08945 (англ.). Процитовано 21 серпня 2017. 

Див. також[ред. | ред. код]