ZNF74

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ZNF74
Ідентифікатори
Символи ZNF74, COS52, ZFP520, ZNF520, hZNF7, zinc finger protein 74
Зовнішні ІД OMIM: 194548 HomoloGene: 88675 GeneCards: ZNF74
Шаблон експресії
PBB GE ZNF74 205881 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_001256523
NM_001256524
NM_001256525
NM_003426
н/д
RefSeq (білок)
NP_001243452
NP_001243453
NP_001243454
NP_003417
н/д
Локус (UCSC) Хр. 22: 20.39 – 20.41 Mb н/д
PubMed search [1] н/д
Вікідані
Див./Ред. для людей

ZNF74 (англ. Zinc finger protein 74) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 22-ї хромосоми.[2] Довжина поліпептидного ланцюга білка становить 644 амінокислот, а молекулярна маса — 72 207[3].

Послідовність амінокислот
1020304050
MEIPAPEPEKTALSSQDPALSLKENLEDISGWGLPEARSKESVSFKDVAV
DFTQEEWGQLDSPQRALYRDVMLENYQNLLALGPPLHKPDVISHLERGEE
PWSMQREVPRGPCPEWELKAVPSQQQGICKEEPAQEPIMERPLGGAQAWG
RQAGALQRSQAAPWAPAPAMVWDVPVEEFPLRCPLFAQQRVPEGGPLLDT
RKNVQATEGRTKAPARLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVC
GECGKAFRQSSSLTLHRRWHSREKAYKCDECGKAFTWSTNLLEHRRIHTG
EKPFFCGECGKAFSCHSSLNVHQRIHTGERPYKCSACEKAFSCSSLLSMH
LRVHTGEKPYRCGECGKAFNQRTHLTRHHRIHTGEKPYQCGSCGKAFTCH
SSLTVHEKIHSGDKPFKCSDCEKAFNSRSRLTLHQRTHTGEKPFKCADCG
KGFSCHAYLLVHRRIHSGEKPFKCNECGKAFSSHAYLIVHRRIHTGEKPF
DCSQCWKAFSCHSSLIVHQRIHTGEKPYKCSECGRAFSQNHCLIKHQKIH
SGEKSFKCEKCGEMFNWSSHLTEHQRLHSEGKPLAIQFNKHLLSTYYVPG
SLLGAGDAGLRDVDPIDALDVAKLLCVVPPRAGRNFSLGSKPRN

Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку, ДНК, РНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Grondin B., Bazinet M., Aubry M. (1996). The KRAB zinc finger gene ZNF74 encodes an RNA-binding protein tightly associated with the nuclear matrix.. J. Biol. Chem. 271: 15458 — 15467.  PubMed DOI:10.1074/jbc.271.26.15458
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. HUGO Gene Nomenclature Commitee, HGNC:13144 (англ.). Процитовано 12 вересня 2017. 
  3. UniProt, Q16587 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]