HES1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
HES1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи HES1, HES-1, HHL, HRY, bHLHb39, hes family bHLH transcription factor 1
Зовнішні ІД OMIM: 139605 MGI: 104853 HomoloGene: 38067 GeneCards: HES1
Шаблон експресії
PBB GE HES1 203394 s at fs.png

PBB GE HES1 203395 s at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005524
NM_008235
RefSeq (білок)
NP_005515
NP_032261
Локус (UCSC) Хр. 3: 194.14 – 194.14 Mb Хр. 16: 30.06 – 30.07 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

HES1 (англ. Hes family bHLH transcription factor 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 3-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 280 амінокислот, а молекулярна маса — 29 541[4].

Послідовність амінокислот
1020304050
MPADIMEKNSSSPVAATPASVNTTPDKPKTASEHRKSSKPIMEKRRRARI
NESLSQLKTLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMTAAL
STDPSVLGKYRAGFSECMNEVTRFLSTCEGVNTEVRTRLLGHLANCMTQI
NAMTYPGQPHPALQAPPPPPPGPGGPQHAPFAPPPPLVPIPGGAAPPPGG
APCKLGSQAGEAAKVFGGFQVVPAPDGQFAFLIPNGAFAHSGPVIPVYTS
NSGTSVGPNAVSPSSGPSLTADSMWRPWRN

Кодований геном білок за функцією належить до репресорів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Feder J.N., Li L., Jan L.Y., Jan Y.-N. (1994). Genomic cloning and chromosomal localization of HRY, the human homolog to the Drosophila segmentation gene, hairy.. Genomics 20: 56 — 61.  PubMed DOI:10.1006/geno.1994.1126
  • Takata T., Ishikawa F. (2003). Human Sir2-related protein SIRT1 associates with the bHLH repressors HES1 and HEY2 and is involved in HES1- and HEY2-mediated transcriptional repression.. Biochem. Biophys. Res. Commun. 301: 250 — 257.  PubMed DOI:10.1016/S0006-291X(02)03020-6

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:5192 (англ.). Процитовано 30 серпня 2017. 
  4. UniProt, Q14469 (англ.). Процитовано 30 серпня 2017. 

Див. також[ред. | ред. код]