ING3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
ING3
Protein ING3 PDB 1x4i.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи ING3, Eaf4, ING2, MEAF4, p47inhibitor of growth family member 3
Зовнішні ІД OMIM: 607493 MGI: 1919027 HomoloGene: 6804 GeneCards: ING3
Пов'язані генетичні захворювання
head and neck squamous cell carcinoma[1]
Шаблон експресії
PBB GE ING3 205070 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_198267
NM_019071
NM_198266
NM_023626
NM_001311061
RefSeq (білок)
NP_061944
NP_938008
NP_001297990
NP_076115
Локус (UCSC) Хр. 7: 120.95 – 120.98 Mb Хр. 6: 21.95 – 21.98 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ING3 (англ. Inhibitor of growth family member 3) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 7-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 418 амінокислот, а молекулярна маса — 46 743[5].

Послідовність амінокислот
1020304050
MLYLEDYLEMIEQLPMDLRDRFTEMREMDLQVQNAMDQLEQRVSEFFMNA
KKNKPEWREEQMASIKKDYYKALEDADEKVQLANQIYDLVDRHLRKLDQE
LAKFKMELEADNAGITEILERRSLELDTPSQPVNNHHAHSHTPVEKRKYN
PTSHHTTTDHIPEKKFKSEALLSTLTSDASKENTLGCRNNNSTASSNNAY
NVNSSQPLGSYNIGSLSSGTGAGAITMAAAQAVQATAQMKEGRRTSSLKA
SYEAFKNNDFQLGKEFSMARETVGYSSSSALMTTLTQNASSSAADSRSGR
KSKNNNKSSSQQSSSSSSSSSLSSCSSSSTVVQEISQQTTVVPESDSNSQ
VDWTYDPNEPRYCICNQVSYGEMVGCDNQDCPIEWFHYGCVGLTEAPKGK
WYCPQCTAAMKRRGSRHK

Кодований геном білок за функцією належить до регуляторів хроматину. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, регуляція росту, ацетилювання, альтернативний сплайсинг. Білок має сайт для зв'язування з іонами металів, іоном цинку. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Doyon Y., Cote J. (2004). The highly conserved and multifunctional NuA4 HAT complex.. Curr. Opin. Genet. Dev. 14: 147 — 154.  PubMed DOI:10.1016/j.gde.2004.02.009
  • Doyon Y., Selleck W., Lane W.S., Tan S., Cote J. (2004). Structural and functional conservation of the NuA4 histone acetyltransferase complex from yeast to humans.. Mol. Cell. Biol. 24: 1884 — 1896.  PubMed DOI:10.1128/MCB.24.5.1884-1896.2004
  • Lee W.Y., Lee D., Chung W.I., Kwon C.S. (2009). Arabidopsis ING and Alfin1-like protein families localize to the nucleus and bind to H3K4me3/2 via plant homeodomain fingers.. Plant J. 58: 511 — 524.  PubMed DOI:10.1111/j.1365-313X.2009.03795.x
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

Див. також[ред. | ред. код]