TAF10

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
TAF10
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи TAF10, TAF2A, TAF2H, TAFII30, TATA-box binding protein associated factor 10
Зовнішні ІД OMIM: 600475 MGI: 1346320 HomoloGene: 86923 GeneCards: TAF10
Шаблон експресії
PBB GE TAF10 200056 s at fs.png

PBB GE TAF10 200055 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_006284
NM_020024
RefSeq (білок)
NP_006275
NP_064408
Локус (UCSC) Хр. 11: 6.61 – 6.61 Mb Хр. 7: 105.74 – 105.74 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

TAF10 (англ. TATA-box binding protein associated factor 10) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 11-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 218 амінокислот, а молекулярна маса — 21 711[4].

Послідовність амінокислот
1020304050
MSCSGSGADPEAAPASAASAPGPAPPVSAPAALPSSTAAENKASPAGTAG
GPGAGAAAGGTGPLAARAGEPAERRGAAPVSAGGAAPPEGAISNGVYVLP
SAANGDVKPVVSSTPLVDFLMQLEDYTPTIPDAVTGYYLNRAGFEASDPR
IIRLISLAAQKFISDIANDALQHCKMKGTASGSSRSKSKDRKYTLTMEDL
TPALSEYGINVKKPHYFT

Кодований геном білок за функцією належить до фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, ацетилювання. Локалізований у ядрі.

Література[ред. | ред. код]

  • Scheer E., Mattei M.-G., Jacq X., Chambon P., Tora L. (1995). Organization and chromosomal localization of the gene (TAF2H) encoding the human TBP-associated factor II 30 (TAFII30).. Genomics 29: 269 — 272.  PubMed DOI:10.1006/geno.1995.1243
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Brand M., Yamamoto K., Staub A., Tora L. (1999). Identification of TATA-binding protein-free TAFII-containing complex subunits suggests a role in nucleosome acetylation and signal transduction.. J. Biol. Chem. 274: 18285 — 18289.  PubMed DOI:10.1074/jbc.274.26.18285
  • Kouskouti A., Scheer E., Staub A., Tora L., Talianidis I. (2004). Gene-specific modulation of TAF10 function by SET9-mediated methylation.. Mol. Cell 14: 175 — 182.  PubMed DOI:10.1016/S1097-2765(04)00182-0
  • Couture J.-F., Collazo E., Hauk G., Trievel R.C. (2006). Structural basis for the methylation site specificity of SET7/9.. Nat. Struct. Mol. Biol. 13: 140 — 146.  PubMed DOI:10.1038/nsmb1045
  • Cavusoglu N., Brand M., Tora L., van Dorsselaer A. (2003). Novel subunits of the TATA binding protein free TAFII-containing transcription complex identified by matrix-assisted laser desorption/ionization-time of flight mass spectrometry following one-dimensional gel electrophoresis.. Proteomics 3: 217 — 223.  PubMed DOI:10.1002/pmic.200390030

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:11543 (англ.). Процитовано 8 вересня 2017. 
  4. UniProt, Q12962 (англ.). Процитовано 8 вересня 2017. 

Див. також[ред. | ред. код]