FOXI1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
FOXI1
Ідентифікатори
Символи FOXI1, FKH10, FKHL10, FREAC-6, FREAC6, HFH-3, HFH3, forkhead box I1
Зовнішні ІД OMIM: 601093 MGI: 1096329 HomoloGene: 8140 GeneCards: FOXI1
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_012188
NM_144769
NM_023907
RefSeq (білок)
NP_036320
NP_658982
NP_076396
Локус (UCSC) Хр. 5: 170.11 – 170.11 Mb Хр. 11: 34.2 – 34.21 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FOXI1 (англ. Forkhead box I1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 5-ї хромосоми. [3] Довжина поліпептидного ланцюга білка становить 378 амінокислот, а молекулярна маса — 40 973[4].

Послідовність амінокислот
1020304050
MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFE
GGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVS
GLGGSDLGWLPIPSQEELMKLVRPPYSYSALIAMAIHGAPDKRLTLSQIY
QYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVPRDEDDPGKGNYWTLD
PNCEKMFDNGNFRRKRKRKSDVSSSTASLALEKTESSLPVDSPKTTEPQD
ILDGASPGGTTSSPEKRPSPPPSGAPCLNSFLSSMTAYVSGGSPTSHPLV
TPGLSPEPSDKTGQNSLTFNSFSPLTNLSNHSGGGDWANPMPTNMLSYGG
SVLSQFSPHFYNSVNTSGVLYPREGTEV

Кодований геном білок за функцією належить до активаторів. Задіяний у таких біологічних процесах як транскрипція, регуляція транскрипції, поліморфізм, альтернативний сплайсинг. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Overdier D.G., Ye H., Peterson R.S., Clevidence D.E., Costa R.H. (1997). The winged helix transcriptional activator HFH-3 is expressed in the distal tubules of embryonic and adult mouse kidney.. J. Biol. Chem. 272: 13725 — 13730.  PubMed DOI:10.1074/jbc.272.21.13725
  • Pierrou S., Hellqvist M., Samuelsson L., Enerbaeck S., Carlsson P. (1994). Cloning and characterization of seven human forkhead proteins: binding site specificity and DNA bending.. EMBO J. 13: 5002 — 5012.  PubMed

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:3815 (англ.). Процитовано 31 серпня 2017. 
  4. UniProt, Q12951 (англ.). Процитовано 31 серпня 2017. 

Див. також[ред. | ред. код]