NFIL3

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NFIL3
Ідентифікатори
Символи NFIL3, E4BP4, IL3BP1, NF-IL3A, NFIL3A, nuclear factor, interleukin 3 regulated
Зовнішні ІД OMIM: 605327 MGI: 109495 HomoloGene: 3928 GeneCards: NFIL3
Шаблон експресії
PBB GE NFIL3 203574 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_005384
NM_001289999
NM_001290000
NM_017373
RefSeq (білок)
NP_001276928
NP_001276929
NP_005375
NP_059069
Локус (UCSC) Хр. 9: 91.41 – 91.42 Mb Хр. 13: 52.97 – 52.98 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NFIL3 (англ. Nuclear factor, interleukin 3 regulated) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 9-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 462 амінокислот, а молекулярна маса — 51 472[4].

Послідовність амінокислот
1020304050
MQLRKMQTVKKEQASLDASSNVDKMMVLNSALTEVSEDSTTGEELLLSEG
SVGKNKSSACRRKREFIPDEKKDAMYWEKRRKNNEAAKRSREKRRLNDLV
LENKLIALGEENATLKAELLSLKLKFGLISSTAYAQEIQKLSNSTAVYFQ
DYQTSKSNVSSFVDEHEPSMVSSSCISVIKHSPQSSLSDVSEVSSVEHTQ
ESSVQGSCRSPENKFQIIKQEPMELESYTREPRDDRGSYTASIYQNYMGN
SFSGYSHSPPLLQVNRSSSNSPRTSETDDGVVGKSSDGEDEQQVPKGPIH
SPVELKHVHATVVKVPEVNSSALPHKLRIKAKAMQIKVEAFDNEFEATQK
LSSPIDMTSKRHFELEKHSAPSMVHSSLTPFSVQVTNIQDWSLKSEHWHQ
KELSGKTQNSFKTGVVEMKDSGYKVSDPENLYLKQGIANLSAEVVSLKRL
IATQPISASDSG

Кодований геном білок за функціями належить до репресорів, активаторів, фосфопротеїнів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, біологічні ритми. Білок має сайт для зв'язування з ДНК. Локалізований у ядрі.

Література[ред. | ред. код]

  • Cowell I.G., Skinner A., Hurst H.C. (1992). Transcriptional repression by a novel member of the bZIP family of transcription factors.. Mol. Cell. Biol. 12: 3070 — 3077.  PubMed DOI:10.1128/MCB.12.7.3070
  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Cowell I.G., Hurst H.C. (1996). Protein-protein interaction between the transcriptional repressor E4BP4 and the TBP-binding protein Dr1.. Nucleic Acids Res. 24: 3607 — 3613.  PubMed DOI:10.1093/nar/24.18.3607
  • Hulme D.J., Blair I.P., Dawkins J.L., Nicholson G.A. (2000). Exclusion of NFIL3 as the gene causing hereditary sensory neuropathy type I by mutation analysis.. Hum. Genet. 106: 594 — 596.  PubMed DOI:10.1007/s004390000306
  • Impens F., Radoshevich L., Cossart P., Ribet D. (2014). Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.. Proc. Natl. Acad. Sci. U.S.A. 111: 12432 — 12437.  PubMed DOI:10.1073/pnas.1413825111
  • Hendriks I.A., Treffers L.W., Verlaan-de Vries M., Olsen J.V., Vertegaal A.C. (2015). SUMO-2 orchestrates chromatin modifiers in response to DNA damage.. Cell Rep. 10: 1778 — 1791.  PubMed DOI:10.1016/j.celrep.2015.02.033

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7787 (англ.). Процитовано 7 вересня 2017. 
  4. UniProt, Q16649 (англ.). Процитовано 7 вересня 2017. 

Див. також[ред. | ред. код]