NR0B1

Матеріал з Вікіпедії — вільної енциклопедії.
Перейти до навігації Перейти до пошуку
NR0B1
3F5C.png
Наявні структури
PDBПошук ортологів: PDBe RCSB
Ідентифікатори
Символи NR0B1, AHC, AHCH, AHX, DAX-1, DAX1, DSS, GTD, HHG, NROB1, SRXY2, nuclear receptor subfamily 0 group B member 1
Зовнішні ІД OMIM: 300473 MGI: 1352460 HomoloGene: 403 GeneCards: NR0B1
Шаблон експресії
PBB GE NR0B1 206645 s at fs.png

PBB GE NR0B1 206644 at fs.png
Більше даних
Ортологи
Види Людина Миша
Entrez
Ensembl
UniProt
RefSeq (мРНК)
NM_000475
NM_007430
RefSeq (білок)
NP_000466
NP_000466.2
NP_031456
Локус (UCSC) Хр. X: 30.3 – 30.31 Mb Хр. X: 86.19 – 86.2 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

NR0B1 (англ. Nuclear receptor subfamily 0 group B member 1) – білок, який кодується однойменним геном, розташованим у людей на X-хромосомі.[3] Довжина поліпептидного ланцюга білка становить 470 амінокислот, а молекулярна маса — 51 718[4].

Послідовність амінокислот
1020304050
MAGENHQWQGSILYNMLMSAKQTRAAPEAPETRLVDQCWGCSCGDEPGVG
REGLLGGRNVALLYRCCFCGKDHPRQGSILYSMLTSAKQTYAAPKAPEAT
LGPCWGCSCGSDPGVGRAGLPGGRPVALLYRCCFCGEDHPRQGSILYSLL
TSSKQTHVAPAAPEARPGGAWWDRSYFAQRPGGKEALPGGRATALLYRCC
FCGEDHPQQGSTLYCVPTSTNQAQAAPEERPRAPWWDTSSGALRPVALKS
PQVVCEAASAGLLKTLRFVKYLPCFQVLPLDQQLVLVRNCWASLLMLELA
QDRLQFETVEVSEPSMLQKILTTRRRETGGNEPLPVPTLQHHLAPPAEAR
KVPSASQVQAIKCFLSKCWSLNISTKEYAYLKGTVLFNPDVPGLQCVKYI
QGLQWGTQQILSEHTRMTHQGPHDRFIELNSTLFLLRFINANVIAELFFR
PIIGTVSMDDMMLEMLCTKI

Кодований геном білок за функціями належить до репресорів, рецепторів. Задіяний у таких біологічних процесах, як транскрипція, регуляція транскрипції, альтернативний сплайсинг. Локалізований у цитоплазмі, ядрі.

Література[ред. | ред. код]

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).. Genome Res. 14: 2121 — 2127. 2004.  PubMed DOI:10.1101/gr.2596504
  • Suzuki T., Kasahara M., Yoshioka H., Morohashi K., Umesono K. (2003). LXXLL-related motifs in Dax-1 have target specificity for the orphan nuclear receptors Ad4BP/SF-1 and LRH-1.. Mol. Cell. Biol. 23: 238 — 249.  PubMed DOI:10.1128/MCB.23.1.238-249.2003
  • Ho J., Zhang Y.H., Huang B.L., McCabe E.R.B. (2004). NR0B1A: an alternatively spliced form of NR0B1.. Mol. Genet. Metab. 83: 330 — 336.  PubMed DOI:10.1016/j.ymgme.2004.10.002
  • Niakan K.K., McCabe E.R.B. (2005). DAX1 origin, function, and novel role.. Mol. Genet. Metab. 86: 70 — 83.  PubMed DOI:10.1016/j.ymgme.2005.07.019
  • Iyer A.K., Zhang Y.-H., McCabe E.R.B. (2006). Dosage-sensitive sex reversal adrenal hypoplasia congenita critical region on the X chromosome, gene 1 (DAX1) (NR0B1) and small heterodimer partner (SHP) (NR0B2) form homodimers individually, as well as DAX1-SHP heterodimers.. Mol. Endocrinol. 20: 2326 — 2342.  PubMed DOI:10.1210/me.2005-0383
  • Schwartz M., Blichfeldt S., Mueller J. (1997). X-linked adrenal hypoplasia in a large Greenlandic family. Detection of a missense mutation (N4401) in the DAX-1 gene; implication for genetic counselling and carrier diagnosis.. Hum. Genet. 99: 83 — 87.  PubMed DOI:10.1007/s004390050316

Примітки[ред. | ред. код]

  1. Human PubMed Reference:. 
  2. Mouse PubMed Reference:. 
  3. HUGO Gene Nomenclature Commitee, HGNC:7960 (англ.). Процитовано 12 вересня 2017. 
  4. UniProt, P51843 (англ.). Процитовано 12 вересня 2017. 

Див. також[ред. | ред. код]